SitesBLAST
Comparing YP_004144908.1 NCBI__GCF_000185905.1:YP_004144908.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
7koeA Electron bifurcating flavoprotein fix/etfabcx (see paper)
42% identity, 94% coverage: 2:266/282 of query aligns to 3:264/282 of 7koeA
- binding flavin-adenine dinucleotide: C7 (≠ S6), I8 (= I7), K9 (= K8), D39 (= D38), M62 (= M61), A93 (≠ S92), D94 (= D93), T95 (= T94), T98 (= T97), L102 (= L101), T121 (= T120), G122 (= G121), A125 (≠ T124), G128 (= G127), T130 (= T129), G131 (≠ A130), V133 (= V132)
4l2iB Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
45% identity, 84% coverage: 1:238/282 of query aligns to 1:229/263 of 4l2iB
- binding flavin-adenine dinucleotide: C6 (≠ S6), V7 (≠ I7), K8 (= K8), Y37 (= Y37), D38 (= D38), Y40 (≠ F40), T60 (= T60), M61 (= M61), A92 (≠ S92), D93 (= D93), T94 (= T94), T97 (= T97), M101 (≠ L101), C116 (≠ T120), G117 (= G121), Q119 (= Q123), A120 (≠ T124), G123 (= G127), T125 (= T129), A126 (= A130), V128 (= V132)
- binding nicotinamide-adenine-dinucleotide: M61 (= M61), G62 (= G62), P63 (= P63), S85 (≠ T85), D86 (= D86), G91 (= G91)
4kpuB Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
45% identity, 84% coverage: 1:238/282 of query aligns to 1:229/263 of 4kpuB
- binding flavin-adenine dinucleotide: C6 (≠ S6), V7 (≠ I7), K8 (= K8), Y37 (= Y37), D38 (= D38), Y40 (≠ F40), M61 (= M61), A92 (≠ S92), D93 (= D93), T94 (= T94), T97 (= T97), C116 (≠ T120), G117 (= G121), Q119 (= Q123), A120 (≠ T124), G123 (= G127), T125 (= T129), A126 (= A130), V128 (= V132)
5ol2B The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
45% identity, 85% coverage: 1:241/282 of query aligns to 1:233/260 of 5ol2B
- binding flavin-adenine dinucleotide: C6 (≠ S6), I7 (= I7), K8 (= K8), D38 (= D38), M61 (= M61), A92 (≠ S92), D93 (= D93), T94 (= T94), T97 (= T97), A115 (≠ T120), G116 (= G121), A119 (≠ T124), G122 (= G127), T124 (= T129), A125 (= A130), V127 (= V132)
6fahB Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
43% identity, 85% coverage: 1:241/282 of query aligns to 1:234/262 of 6fahB
- binding flavin-adenine dinucleotide: C6 (≠ S6), A7 (≠ I7), K8 (= K8), D38 (= D38), T61 (= T60), M62 (= M61), A93 (≠ S92), D94 (= D93), T95 (= T94), T98 (= T97), L102 (= L101), G118 (= G121), Q120 (= Q123), G124 (= G127), T126 (= T129), A127 (= A130), V129 (= V132), T223 (= T230)
7qh2B Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
37% identity, 87% coverage: 2:246/282 of query aligns to 3:242/265 of 7qh2B
- binding flavin-adenine dinucleotide: C7 (≠ S6), K9 (= K8), D39 (= D38), M62 (= M61), D94 (= D93), V95 (≠ T94), L102 (= L101), G118 (= G121), Q120 (= Q123), T121 (= T124), T126 (= T129), A127 (= A130), V129 (= V132)
Q9DCW4 Electron transfer flavoprotein subunit beta; Beta-ETF from Mus musculus (Mouse) (see paper)
32% identity, 78% coverage: 1:221/282 of query aligns to 4:219/255 of Q9DCW4
- K200 (≠ S201) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; alternate
- K203 (≠ R204) modified: N6,N6,N6-trimethyllysine; by ETFBKMT
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
Q2TBV3 Electron transfer flavoprotein subunit beta; Beta-ETF from Bos taurus (Bovine) (see paper)
32% identity, 78% coverage: 1:221/282 of query aligns to 4:219/255 of Q2TBV3
- K200 (≠ S201) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; alternate
- K203 (≠ R204) modified: N6,N6,N6-trimethyllysine; by ETFBKMT
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
P38117 Electron transfer flavoprotein subunit beta; Beta-ETF from Homo sapiens (Human) (see 10 papers)
32% identity, 78% coverage: 1:221/282 of query aligns to 4:219/255 of P38117
- A9 (≠ S6) binding AMP
- NPFC 39:42 (≠ NPYD 35:38) binding AMP
- C66 (≠ M61) binding AMP
- 123:134 (vs. 121:132, 58% identical) binding AMP
- D128 (= D126) to N: in GA2B; decreased protein stability; dbSNP:rs104894678
- T154 (≠ A152) to M: in dbSNP:rs1130426
- R164 (= R165) to Q: in GA2B; reduced electron transfer activity; dbSNP:rs104894677
- E165 (≠ R166) mutation E->A,Q: Drastically increases interprotein electron transfer rates.
- 183:205 (vs. 184:206, 17% identical) Recognition loop
- L195 (≠ I196) mutation to A: Severely impaired in complex formation with ACADM.
- K200 (≠ S201) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; alternate; mutation to R: Does not abolish electron transfer activity. Decreases sensitivity to inhibition by lysine methyltransferase ETFBKMT.
- KAK 200:202 (≠ SAA 201:203) mutation to RAR: Does not abolish methylation by ETFBKMT.
- KAKK 200:203 (≠ SAAR 201:204) mutation to RAKR: Does not abolish electron transfer activity. Abolishes sensitivity to inhibition by lysine methyltransferase ETFBKMT.
- K203 (≠ R204) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; mutation to R: Does not abolish electron transfer activity. Decreases sensitivity to inhibition by lysine methyltransferase ETFBKMT.
2a1uB Crystal structure of the human etf e165betaa mutant (see paper)
32% identity, 78% coverage: 1:221/282 of query aligns to 1:216/252 of 2a1uB
- binding adenosine monophosphate: A6 (≠ S6), V7 (≠ I7), K8 (= K8), C39 (≠ D38), C63 (≠ M61), V101 (≠ L101), L119 (≠ T120), G120 (= G121), Q122 (= Q123), A123 (≠ T124), D126 (≠ G127), C128 (≠ T129), N129 (≠ A130), Q130 (= Q131), T131 (≠ V132)
- binding flavin-adenine dinucleotide: P37 (= P36), L182 (≠ E186)
1efpB Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
29% identity, 77% coverage: 1:218/282 of query aligns to 1:214/246 of 1efpB
- binding adenosine monophosphate: P6 (≠ S6), V7 (≠ I7), D39 (= D38), I63 (≠ M61), V101 (≠ L101), A119 (≠ T120), G120 (= G121), Q122 (= Q123), A123 (≠ T124), N126 (≠ G127), M128 (≠ T129), N129 (≠ A130), T131 (≠ V132)
- binding flavin-adenine dinucleotide: Y13 (vs. gap), L182 (≠ E186)
1o96A Structure of electron transferring flavoprotein for methylophilus methylotrophus. (see paper)
31% identity, 73% coverage: 34:238/282 of query aligns to 34:234/261 of 1o96A
- binding adenosine monophosphate: D38 (= D38), V63 (vs. gap), V99 (≠ T97), A117 (≠ T120), G118 (= G121), Q120 (= Q123), S121 (≠ T124), Y126 (≠ T129), A127 (= A130), T129 (≠ V132)
- binding flavin-adenine dinucleotide: Q120 (= Q123), Q182 (≠ L185)
Sites not aligning to the query:
P53570 Electron transfer flavoprotein subunit beta; Beta-ETF; Electron transfer flavoprotein small subunit; ETFSS from Methylophilus methylotrophus (Bacterium W3A1) (see paper)
31% identity, 73% coverage: 34:238/282 of query aligns to 35:235/264 of P53570
Sites not aligning to the query:
5ow0B Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
30% identity, 55% coverage: 1:155/282 of query aligns to 1:149/251 of 5ow0B
- binding adenosine monophosphate: L6 (≠ S6), A7 (≠ I7), K8 (= K8), D39 (= D38), Y62 (≠ M61), I95 (≠ T97), A114 (≠ T120), G115 (= G121), Q117 (= Q123), S118 (≠ T124), R123 (≠ T129), G124 (≠ A130), V125 (≠ Q131), V126 (= V132), P127 (≠ G133)
- binding flavin-adenine dinucleotide: L37 (≠ P36), Y38 (= Y37)
Query Sequence
>YP_004144908.1 NCBI__GCF_000185905.1:YP_004144908.1
MHIVVSIKQVPDSAQIRVHPVTNTIMRQGVPTIINPYDLFALEEALRLRDAYGGEVTVLT
MGPPMAEDSLRKALGYGADRAVLLTDRYFAGSDTLATSLALSQAIAKIGETFGTPDVVFT
GKQTIDGDTAQVGPGIAKRLDLSQLTYVARIATIDLAAREITVERRCEGGTQTLKSKLPC
LITMLEGTNEMRRGSIEDALSAARRQVVKWSAAEAGIEDLTKCGLRGSPTVVRRVFAPTA
RSEKAAQIDTAEKTLRDLADELIVAIFTRQPALEPELAFDGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory