Align Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 (characterized)
to candidate 199473 SO0278 argininosuccinate synthase (NCBI ptt file)
Query= SwissProt::P59846 (400 letters) >FitnessBrowser__MR1:199473 Length = 407 Score = 422 bits (1085), Expect = e-123 Identities = 213/393 (54%), Positives = 274/393 (69%), Gaps = 2/393 (0%) Query: 2 KIVLAYSGGLDTSIILKWLKETY-RAEVIAFTADIGQGEE-VEEAREKALRTGASKAIAL 59 K+VLAYSGGLDTS I+ WLKE Y E+IAF AD+GQGEE + EKAL +GAS+ + Sbjct: 12 KVVLAYSGGLDTSAIIPWLKENYDNCEIIAFCADVGQGEEELIGLTEKALASGASECHIV 71 Query: 60 DLKEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKG 119 DLKEEFV+D+++P M GA+YEG YLLGTS+ARP+IAK V +A + GA+A+ HG TGKG Sbjct: 72 DLKEEFVKDYIYPTMATGAIYEGTYLLGTSMARPIIAKAQVEVARKVGADALCHGCTGKG 131 Query: 120 NDQVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQEKPYSMDANLL 179 NDQVRFE AL PD+KVIAPWREW+ Q R++++AY I + K YS DAN Sbjct: 132 NDQVRFEGCFAALAPDLKVIAPWREWTMQSREDLLAYLAERNIKTSASATKIYSRDANAF 191 Query: 180 HISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPAALL 239 HIS+EGG LEDPW EP KG++ +T DPE+AP+ EYV +E G VNGE L+P A L Sbjct: 192 HISHEGGELEDPWNEPSKGVWTLTADPEDAPNQAEYVSLEVENGRVTKVNGEALTPYAAL 251 Query: 240 QRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQRD 299 +LN I HGVGR+DI ENR VGMKSRG YETPGGT+++ A RA+E L LD+ + R+ Sbjct: 252 MKLNAIAAPHGVGRIDITENRLVGMKSRGCYETPGGTVMFAALRAIEELVLDKTSRNWRE 311 Query: 300 MLSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKSLYR 359 + + A LVY G W+ P ++L A + +A SV G +KLYKG+ V +++P SLY Sbjct: 312 QVGAQMAHLVYDGRWFTPLCKSLLAASESLAESVNGEVVVKLYKGHAIAVKKRSPNSLYS 371 Query: 360 QDLVSFDEAGGYDQKDAEGFIKIQALRLRVRAL 392 + +F E YDQK AEGFI++ +L R+RAL Sbjct: 372 EAFATFGEDQVYDQKHAEGFIRLYSLASRIRAL 404 Lambda K H 0.319 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 436 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 407 Length adjustment: 31 Effective length of query: 369 Effective length of database: 376 Effective search space: 138744 Effective search space used: 138744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 199473 SO0278 (argininosuccinate synthase (NCBI ptt file))
to HMM TIGR00032 (argG: argininosuccinate synthase (EC 6.3.4.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00032.hmm # target sequence database: /tmp/gapView.30207.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00032 [M=394] Accession: TIGR00032 Description: argG: argininosuccinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-138 448.1 0.0 2e-138 447.9 0.0 1.0 1 lcl|FitnessBrowser__MR1:199473 SO0278 argininosuccinate synthas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:199473 SO0278 argininosuccinate synthase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 447.9 0.0 2e-138 2e-138 1 387 [. 12 400 .. 12 407 .] 0.98 Alignments for each domain: == domain 1 score: 447.9 bits; conditional E-value: 2e-138 TIGR00032 1 kvvlaysGGlDtsvalklleek..gaeviavtvdvGqpeedldaieekalklGaekayviDareefvkdylfaaiqana 77 kvvlaysGGlDts+++++l+e+ ++e+ia+++dvGq+ee+l ekal+ Ga + ++D +eefvkdy+ +++ ++a lcl|FitnessBrowser__MR1:199473 12 KVVLAYSGGLDTSAIIPWLKENydNCEIIAFCADVGQGEEELIGLTEKALASGASECHIVDLKEEFVKDYIYPTMATGA 90 8********************99788***************************************************** PP TIGR00032 78 vyegkYllstaLaRpliakklvevakkegaeavahGctgKGnDqvRFelsilllnpdlkviaPvreleli.Reeeieya 155 +yeg+Yll+t++aRp+iak++veva+k ga+a+ hGctgKGnDqvRFe + +l+pdlkviaP+re+ + Re++++y+ lcl|FitnessBrowser__MR1:199473 91 IYEGTYLLGTSMARPIIAKAQVEVARKVGADALCHGCTGKGNDQVRFEGCFAALAPDLKVIAPWREWTMQsREDLLAYL 169 *********************************************************************88******** PP TIGR00032 156 aekGievpvekekaysiDenllgrsiEageLEdpsteppediyelvkdpiektedepevveieFekGvPvalngeslep 234 ae+ i++ ++ k ys D n +++s+E+geLEdp+ ep + +++l++dp++++ +++e+v +e e+G ++nge l+p lcl|FitnessBrowser__MR1:199473 170 AERNIKTSASATKIYSRDANAFHISHEGGELEDPWNEPSKGVWTLTADPEDAP-NQAEYVSLEVENGRVTKVNGEALTP 247 ***********************************************999998.999********************** PP TIGR00032 235 velilkaneiagkhGvGriDivEdRiiglKsReiYEapalllLikAhkdLetlvltkdvlefkeiveekyseliYkGlw 313 + k+n ia hGvGriDi E+R++g+KsR++YE+p+ +++ A +++e+lvl+k ++++e v+ ++++l+Y G+w lcl|FitnessBrowser__MR1:199473 248 YAALMKLNAIAAPHGVGRIDITENRLVGMKSRGCYETPGGTVMFAALRAIEELVLDKTSRNWREQVGAQMAHLVYDGRW 326 ******************************************************************************* PP TIGR00032 314 fdplaealdalikktqervtGtvrvklfkGnaivigrkseyslYdeelvsfekdkefdqkdaiGfikirglqik 387 f pl++ l a+ + +e+v+G+v vkl+kG+ai + ++s++slY+e ++f +d+ +dqk+a+Gfi++++l + lcl|FitnessBrowser__MR1:199473 327 FTPLCKSLLAASESLAESVNGEVVVKLYKGHAIAVKKRSPNSLYSEAFATFGEDQVYDQKHAEGFIRLYSLASR 400 *********************************************************************99866 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (407 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.81 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory