Align ribokinase (EC 2.7.1.15) (characterized)
to candidate 199996 SO0810 ribokinase (NCBI ptt file)
Query= BRENDA::A0A0H2UL04 (309 letters) >FitnessBrowser__MR1:199996 Length = 303 Score = 277 bits (708), Expect = 3e-79 Identities = 155/301 (51%), Positives = 200/301 (66%), Gaps = 3/301 (0%) Query: 4 MNKLVVLGSVNADHVLQVPSFPRPGETLHGRNYQVIPGGKGANQAVAAARM---QADVGF 60 M+ ++V+GS NADHV+ P PG+TL R+Y++ GGKGANQAVA AR+ + V F Sbjct: 1 MSHILVIGSANADHVMNFEYLPVPGQTLKSRSYRLEHGGKGANQAVACARLCLPDSRVDF 60 Query: 61 IACVGDDSFGINIRESFKLDGINTAGVKLQPNCPTGIAMIQVSDSGENSICISAEANAKL 120 I +G DS G +R+S+ DGI G+ L N TG AMI V+D+GEN+I I+A ANA L Sbjct: 61 ICHLGQDSIGNEMRDSWLKDGIQAEGITLVDNVSTGTAMIFVADNGENAIGIAAGANAHL 120 Query: 121 TAAAIEPDLAAIRDARYLLMQLETPLDGILKAAQEAKTAKTNVILNPAPARELPDELLKC 180 T +E A +A+YLL+QLETP + + A Q AK +LNPAPA + LK Sbjct: 121 TPLELEKHYALFANAQYLLIQLETPTETVSNALQMAKRLGITTVLNPAPAATQELDYLKW 180 Query: 181 VDLITPNETEAEVLTGITVYDDSSAQQAADALHCKGIEIVIITLGSKGVWLSQNGRGQRI 240 VD+ITPNETEAE LTGI V + A+ AA LH +GI V+ITLGSKG ++S G I Sbjct: 181 VDIITPNETEAEALTGIEVKHEEDAKLAAQWLHQQGITTVVITLGSKGAFISSPGFTGLI 240 Query: 241 PGFVVKATDTTAAGDTFNGALVTGLLQEMPLESAIKFAHAAAAISVTRFGAQTSIPTRAE 300 P V+A DT AAGDTFNGALV GL + M + +A+ FA+AA+AI+VTR GAQ +IP R+E Sbjct: 241 PALTVQAIDTVAAGDTFNGALVVGLSEGMSIAAAVSFANAASAITVTREGAQRAIPYRSE 300 Query: 301 V 301 V Sbjct: 301 V 301 Lambda K H 0.316 0.132 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 303 Length adjustment: 27 Effective length of query: 282 Effective length of database: 276 Effective search space: 77832 Effective search space used: 77832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate 199996 SO0810 (ribokinase (NCBI ptt file))
to HMM TIGR02152 (rbsK: ribokinase (EC 2.7.1.15))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02152.hmm # target sequence database: /tmp/gapView.24672.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02152 [M=298] Accession: TIGR02152 Description: D_ribokin_bact: ribokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-120 386.5 1.1 4.7e-120 386.4 1.1 1.0 1 lcl|FitnessBrowser__MR1:199996 SO0810 ribokinase (NCBI ptt file Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:199996 SO0810 ribokinase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 386.4 1.1 4.7e-120 4.7e-120 1 297 [. 4 302 .. 4 303 .] 0.99 Alignments for each domain: == domain 1 score: 386.4 bits; conditional E-value: 4.7e-120 TIGR02152 1 ivvvGSinvDlvlrvkrlpkpGetvkaeefkiaaGGKGANQAvaaarlg...aevsmigkvGkDefgeellenlkkegi 76 i+v+GS+n+D+v+++++lp+pG+t+k++++++ +GGKGANQAva+arl+ ++v++i+++G+D++g+e+++++ k+gi lcl|FitnessBrowser__MR1:199996 4 ILVIGSANADHVMNFEYLPVPGQTLKSRSYRLEHGGKGANQAVACARLClpdSRVDFICHLGQDSIGNEMRDSWLKDGI 82 89************************************************999************************** PP TIGR02152 77 dteyvkkvkktstGvAlilvdeegeNsIvvvaGaneeltpedvkaaeekikesdlvllQlEipletveealkiakkagv 155 ++e ++ v+++stG+A+i+v+++geN+I ++aGan++ltp +++++ + +++++++l+QlE+p+etv++al++ak+ g+ lcl|FitnessBrowser__MR1:199996 83 QAEGITLVDNVSTGTAMIFVADNGENAIGIAAGANAHLTPLELEKHYALFANAQYLLIQLETPTETVSNALQMAKRLGI 161 ******************************************************************************* PP TIGR02152 156 kvllnPAPaekkldeellslvdiivpNetEaeiLtgievedledaekaaekllekgvkaviitlGskGallvskdekkl 234 +++lnPAPa++ ++ ++l++vdii+pNetEae+Ltgiev+++eda+ aa++l+++g+++v+itlGskGa+++s + + l lcl|FitnessBrowser__MR1:199996 162 TTVLNPAPAAT-QELDYLKWVDIITPNETEAEALTGIEVKHEEDAKLAAQWLHQQGITTVVITLGSKGAFISSPGFTGL 239 *********65.789**************************************************************** PP TIGR02152 235 ipalkvkavDttaAGDtFigalavaLaegksledavrfanaaaalsVtrkGaqssiPtkeeve 297 ipal+v+a+Dt+aAGDtF+gal+v L+eg+s+++av+fanaa+a++Vtr+Gaq++iP+++ev+ lcl|FitnessBrowser__MR1:199996 240 IPALTVQAIDTVAAGDTFNGALVVGLSEGMSIAAAVSFANAASAITVTREGAQRAIPYRSEVS 302 *************************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (303 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.59 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory