Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate 201554 SO2410 phosphoserine aminotransferase (NCBI ptt file)
Query= BRENDA::P23721 (362 letters) >FitnessBrowser__MR1:201554 Length = 367 Score = 410 bits (1053), Expect = e-119 Identities = 212/364 (58%), Positives = 270/364 (74%), Gaps = 5/364 (1%) Query: 1 MAQIFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDL 60 ++ I+NF +GPAMLPA V+K+AQQEL DWNGLG SVMEVSHRGKEFI + ++AE D R+L Sbjct: 3 VSAIYNFCAGPAMLPAAVMKKAQQELLDWNGLGVSVMEVSHRGKEFIALTKQAEADLREL 62 Query: 61 LNVPSNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFD 120 +++P NY VLF HGGGRGQF+AV N LG++ A Y+ +G W+++A+ EA+K D Sbjct: 63 MHIPQNYHVLFMHGGGRGQFSAVVNNFLGNQGRALYLVSGQWSSAALAEAQKLAGDAQID 122 Query: 121 AKVTVDG---LRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETPDFGADVVVAADFSS 177 + V+ L AV ++ + Y+HYCPNET+DGI I + D +V AD SS Sbjct: 123 SLNIVEKHNCLNAVVLPDLHKIDADYRYVHYCPNETVDGIEIFDELDSPWPIV--ADLSS 180 Query: 178 TILSRPIDVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSM 237 TI+SR IDVSRYG+IYAGAQKNIGP+GL+IVIVR+D+L ++ SI+DY + ++ SM Sbjct: 181 TIMSREIDVSRYGLIYAGAQKNIGPSGLSIVIVRDDMLTLPSLPQSSIMDYRLAVEHDSM 240 Query: 238 FNTPPTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKANRSR 297 FNTPPTFAWYL+ VF WLK+ GGVA + KINQQKA++LY ID + FY+N V ANRS+ Sbjct: 241 FNTPPTFAWYLAAEVFAWLKSIGGVASIAKINQQKAQMLYACIDANPFYKNGVVAANRSQ 300 Query: 298 MNVPFQLADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALTDFMVEF 357 MNV FQLAD +LD FL+E+ A GL ALKGHR+VGGMRAS+YNAMPLEGV AL FM EF Sbjct: 301 MNVTFQLADESLDGAFLKEAEAVGLVALKGHRIVGGMRASLYNAMPLEGVAALVTFMNEF 360 Query: 358 ERRH 361 +H Sbjct: 361 AAKH 364 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 386 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 367 Length adjustment: 29 Effective length of query: 333 Effective length of database: 338 Effective search space: 112554 Effective search space used: 112554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate 201554 SO2410 (phosphoserine aminotransferase (NCBI ptt file))
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01364.hmm # target sequence database: /tmp/gapView.917.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01364 [M=358] Accession: TIGR01364 Description: serC_1: phosphoserine transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-148 478.7 0.0 5.5e-148 478.5 0.0 1.0 1 lcl|FitnessBrowser__MR1:201554 SO2410 phosphoserine aminotransf Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:201554 SO2410 phosphoserine aminotransferase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 478.5 0.0 5.5e-148 5.5e-148 1 358 [] 6 364 .. 6 364 .. 0.96 Alignments for each domain: == domain 1 score: 478.5 bits; conditional E-value: 5.5e-148 TIGR01364 1 ivnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnyevlflqGGattqfaa 79 i+nF+aGPa+lp +v++kaq+elld+nglg+svme+sHR kef +++++ae dlreL++ip+ny+vlf+ GG+++qf+a lcl|FitnessBrowser__MR1:201554 6 IYNFCAGPAMLPAAVMKKAQQELLDWNGLGVSVMEVSHRGKEFIALTKQAEADLRELMHIPQNYHVLFMHGGGRGQFSA 84 69***************************************************************************** PP TIGR01364 80 vplnllkekkvadyivtGawskkalkeakkltk..evkvvase.eekkyskipdeeelelkedaayvylcanetieGve 155 v n+l ++ a y+v+G+ws+ al+ea+kl ++++++ +++ +++ + +++ d+ yv++c net++G+e lcl|FitnessBrowser__MR1:201554 85 VVNNFLGNQGRALYLVSGQWSSAALAEAQKLAGdaQIDSLNIVeKHNCLNAVVLPDLHKIDADYRYVHYCPNETVDGIE 163 *******************************9867555444442445556666678889999***************** PP TIGR01364 156 fkelpevkkaplvaDlssdilsrkidvskygliyaGaqKniGpaGvtvvivrkdllerakkelpsvldYkilaendsly 234 + ++ + p+vaDlss i+sr+idvs+ygliyaGaqKniGp+G+++vivr+d+l + +s++dY+ ++e+ds++ lcl|FitnessBrowser__MR1:201554 164 IFDEL-DSPWPIVADLSSTIMSREIDVSRYGLIYAGAQKNIGPSGLSIVIVRDDMLTLPSLPQSSIMDYRLAVEHDSMF 241 **998.7889********************************************************************* PP TIGR01364 235 ntpptfaiyvlglvlkwlkekGGvkklekknqeKakllYeaidesegfyknkvekkaRslmnvvFtlkkeelekeFlke 313 ntpptfa+y+++ v+ wlk+ GGv++++k nq+Ka++lY +id++ fykn v +++Rs+mnv+F+l++e l+ Flke lcl|FitnessBrowser__MR1:201554 242 NTPPTFAWYLAAEVFAWLKSIGGVASIAKINQQKAQMLYACIDANP-FYKNGVVAANRSQMNVTFQLADESLDGAFLKE 319 *******************************************886.******************************** PP TIGR01364 314 aeekglvslkGhrsvGGiRasiYnalpleevqaLvdfmkeFekkh 358 ae+ glv+lkGhr+vGG+Ras+Yna+ple+v aLv+fm+eF++kh lcl|FitnessBrowser__MR1:201554 320 AEAVGLVALKGHRIVGGMRASLYNAMPLEGVAALVTFMNEFAAKH 364 ******************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (358 nodes) Target sequences: 1 (367 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 6.90 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory