Align phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) (characterized)
to candidate 202549 SO_3442 nucleoside triphosphate pyrophosphohydrolase (RefSeq)
Query= metacyc::MONOMER-21148 (267 letters) >FitnessBrowser__MR1:202549 Length = 287 Score = 155 bits (393), Expect = 7e-43 Identities = 91/269 (33%), Positives = 146/269 (54%), Gaps = 13/269 (4%) Query: 8 LARLTDVIDRLLAPE-GCPWDKEQTPESLCDYLVEECFELVEAIRSGNADEVREEMGDVM 66 +A L ++++L P+ GCPWDK QT +++ + +EE +E+ + I DE+ +E+GD++ Sbjct: 17 VAPLLKIMEKLRDPQTGCPWDKAQTFQTIVPFTLEEAYEVADTIERLALDELPDELGDLL 76 Query: 67 FLLAFLGRLYADKGAFTLDDAMANNAAKMIRRHPHVFSDTTY---ADRDEFLRNWESIK- 122 F + F +L ++G F + K+ RRHPHVF + + A + NWE+IK Sbjct: 77 FQVVFYCQLGKEQGRFDFSTVVNKIIDKLTRRHPHVFGEAAFEADASSQQMKANWEAIKA 136 Query: 123 --RAEKADAEG----EPQGVYDSLPASLPPLLKAYRIHSKAARVGFTWPEDEDVERQVEA 176 R +KA G V D +P + P L ++ +I + ARVGF WPE E V ++ Sbjct: 137 SEREQKALVAGGNSPSEVSVLDDIPRAQPALSRSIKIQQRVARVGFDWPELEPVVAKIHE 196 Query: 177 EWLELLDVLAGD--DKAAQENELGDLIFSLVELGRRKGIKANTALDMTNLKFLRRFRRME 234 E E+L + D+A + E+GDL+F++V L R + AL N+KF RRF+ +E Sbjct: 197 EIDEVLFEVNQPMLDQAKVQAEMGDLLFAVVNLARHLTVDPEQALRQANIKFERRFKGVE 256 Query: 235 ALARERGLDFPALSLDDKDELWNEAKAAE 263 A AR+ SL++ D W++ K E Sbjct: 257 ACARQNNKALEEHSLEELDAYWDKVKQGE 285 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 287 Length adjustment: 25 Effective length of query: 242 Effective length of database: 262 Effective search space: 63404 Effective search space used: 63404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory