Align LL-diaminopimelate aminotransferase (EC 2.6.1.83) (characterized)
to candidate 207114 DVU1655 aminotransferase, classes I and II
Query= BRENDA::O66630 (387 letters) >MicrobesOnline__882:207114 Length = 388 Score = 479 bits (1232), Expect = e-140 Identities = 237/385 (61%), Positives = 290/385 (75%), Gaps = 1/385 (0%) Query: 2 FEFSDRLKVLPPYLFAELDRKKQEKIEQGVDVIDLGVGDPDMPTPKPIVEAAKKALENPE 61 F+ +DRL LPPYLFA +D+ K E +GVD+I LG+GDPDM TP I+EA K+A+ P Sbjct: 4 FKLADRLATLPPYLFAGIDKVKAEVAARGVDIISLGIGDPDMATPGFIIEAMKEAIARPA 63 Query: 62 NHKYPSYVGKYEFRKAVADWYKRRFDVDLDPNTEVITLIGSKEGIAHFPLAFVNPGDIVL 121 NH+YPSYVG FR+ VA+WY RRF V LDP TEVI LIGSKEGIAHFP AF+NPGD+VL Sbjct: 64 NHQYPSYVGMLAFRQEVANWYDRRFGVSLDPATEVIGLIGSKEGIAHFPFAFINPGDLVL 123 Query: 122 CPDPAYPVYRIGAIFAGGTPYTVPLKEENNFLPDLDSIPEDVAKKAKIIWINYPNNPTSA 181 P YPVY I FAGG VPL EEN+FLPDLD+IPED K+AK+I++NYPNNPT+A Sbjct: 124 VCTPNYPVYHIATGFAGGEVQFVPLLEENDFLPDLDAIPEDTWKRAKMIFVNYPNNPTAA 183 Query: 182 PPTLEFYKKLVDWAKEYNVIIASDNAYSEIYTGQE-KPPSILQVPGAKDVAIEFHSLSKT 240 L FY+KLVD + ++VIIA D AY+EIY ++ +PPSIL VPGAKDVAIEFHSLSKT Sbjct: 184 TAPLGFYEKLVDICRRFDVIIAHDTAYTEIYYDEDNRPPSILSVPGAKDVAIEFHSLSKT 243 Query: 241 YNMTGWRIGMAVGNKELVAGLGKVKTNVDSGQFGAVQDAGIVALNLPEEEVEKIRDVYRE 300 YNMTGWR+GMAVGN LVAGLGK+K N+DSG F AVQ+A IVAL ++ ++R +YR+ Sbjct: 244 YNMTGWRVGMAVGNPTLVAGLGKIKENMDSGIFQAVQEASIVALRDGDDFCRELRGIYRQ 303 Query: 301 RKKIMTEALEKIGLEIYRSDYTFYLWIKVPEGYTSAEFVGRLIDEAGIVCTPGNGFGEYG 360 R+ + AL K G++ TFY+W +VP+G+TSA+FV R++ E G+V TPGNGFG G Sbjct: 304 RRDTVINALHKAGIQCRVPQATFYVWARVPQGHTSADFVTRVLQETGVVVTPGNGFGTPG 363 Query: 361 EGYFRISLTVPTERLLEAAERIKNL 385 EG+FRISLTV RL EA RI L Sbjct: 364 EGFFRISLTVDNARLEEAVSRIAKL 388 Lambda K H 0.317 0.139 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 508 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 388 Length adjustment: 30 Effective length of query: 357 Effective length of database: 358 Effective search space: 127806 Effective search space used: 127806 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate 207114 DVU1655 (aminotransferase, classes I and II)
to HMM TIGR03540 (LL-diaminopimelate aminotransferase (EC 2.6.1.83))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03540.hmm # target sequence database: /tmp/gapView.23445.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03540 [M=383] Accession: TIGR03540 Description: DapC_direct: LL-diaminopimelate aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-191 621.4 0.0 3.2e-191 621.2 0.0 1.0 1 lcl|MicrobesOnline__882:207114 DVU1655 aminotransferase, classe Domain annotation for each sequence (and alignments): >> lcl|MicrobesOnline__882:207114 DVU1655 aminotransferase, classes I and II # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 621.2 0.0 3.2e-191 3.2e-191 1 382 [. 5 387 .. 5 388 .] 0.99 Alignments for each domain: == domain 1 score: 621.2 bits; conditional E-value: 3.2e-191 TIGR03540 1 klaerleklPPylfaeidklkaekkakGvdvidlgiGdPdlptpkeivealkkaaekpenhryPsyeGllayrkavadw 79 kla+rl++lPPylfa idk+kae++a+Gvd+i+lgiGdPd++tp i+ea+k+a+ +p+nh+yPsy+G+la+r++va+w lcl|MicrobesOnline__882:207114 5 KLADRLATLPPYLFAGIDKVKAEVAARGVDIISLGIGDPDMATPGFIIEAMKEAIARPANHQYPSYVGMLAFRQEVANW 83 589**************************************************************************** PP TIGR03540 80 ykkrfgveldpetevlsliGskeGiahlplafvnpGdivlvpdPgyPvykistllaggepyelPlkeendflPdldaip 158 y +rfgv ldp tev++liGskeGiah+p+af+npGd+vlv+ P yPvy+i+t +agge++ +Pl+eendflPdldaip lcl|MicrobesOnline__882:207114 84 YDRRFGVSLDPATEVIGLIGSKEGIAHFPFAFINPGDLVLVCTPNYPVYHIATGFAGGEVQFVPLLEENDFLPDLDAIP 162 ******************************************************************************* PP TIGR03540 159 edvlkkakilflnyPnnPtsavadkeffkevvefakeyniivvhdaayseivfde.ykalsflevdgakdvaielhsls 236 ed++k+ak++f+nyPnnPt+a+a+ f++++v++++ ++i++hd+ay+ei++de ++++s+l+v+gakdvaie+hsls lcl|MicrobesOnline__882:207114 163 EDTWKRAKMIFVNYPNNPTAATAPLGFYEKLVDICRRFDVIIAHDTAYTEIYYDEdNRPPSILSVPGAKDVAIEFHSLS 241 *****************************************************8636899******************* PP TIGR03540 237 ktynmtGWrigfavGnkeliaalgkvksnvdsGvfqaiqeaaiaaleeeeevvkelrkvykkrrdllvealkkiGldvk 315 ktynmtGWr+g+avGn +l+a+lgk+k+n+dsG+fqa+qea+i+al++ +++ +elr +y++rrd++++al+k G++++ lcl|MicrobesOnline__882:207114 242 KTYNMTGWRVGMAVGNPTLVAGLGKIKENMDSGIFQAVQEASIVALRDGDDFCRELRGIYRQRRDTVINALHKAGIQCR 320 ******************************************************************************* PP TIGR03540 316 kpkatfylWvkvPeGytsaefakklleeagvvvtpGvgfGesGeGyirisltvseerlkeaverlkk 382 p+atfy+W++vP+G tsa+f++++l+e+gvvvtpG+gfG+ GeG++risltv++ rl+eav+r++k lcl|MicrobesOnline__882:207114 321 VPQATFYVWARVPQGHTSADFVTRVLQETGVVVTPGNGFGTPGEGFFRISLTVDNARLEEAVSRIAK 387 *****************************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (383 nodes) Target sequences: 1 (388 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.85 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory