Align deoxyribose-phosphate aldolase (EC 4.1.2.4) (characterized)
to candidate 352790 BT3263 putative deoxyribose-phosphate aldolase (NCBI ptt file)
Query= BRENDA::P0A6L0 (259 letters) >FitnessBrowser__Btheta:352790 Length = 300 Score = 166 bits (420), Expect = 5e-46 Identities = 100/240 (41%), Positives = 138/240 (57%), Gaps = 14/240 (5%) Query: 15 MDLTTLNDDDTDEKVIALCHQAKT------PVGNTAAICIYPRFIPIARKTLKEQGTPEI 68 +DLTTLN D+DE V+ + + N AAIC+YP F I + TL+ G I Sbjct: 55 IDLTTLNSTDSDESVMHFTEKVNEFDNEFPDMKNVAAICVYPNFADIVKNTLQVDG---I 111 Query: 69 RIATVTN-FPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKE 127 IA V+ FP I++ +AET AIA GADE+D+V ++G+ + + ++ KE Sbjct: 112 NIACVSGGFPSSQTFIEVKVAETALAIADGADEIDIVISIGKFLSGDYETMCEEIQELKE 171 Query: 128 ACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMME 187 C + LKVI+ETG LK + I+KAS +S+ +GADFIKTSTGK ATPE+A +M E Sbjct: 172 VCKERH--LKVILETGALKTASNIKKASILSMYSGADFIKTSTGKQQPAATPEAAYVMCE 229 Query: 188 VIRD--MGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLL 245 I++ +GFKPAGG+ T DA Y I E+ G +W + R +R G S L LL Sbjct: 230 AIKEYYQKTNNKIGFKPAGGINTVHDAIIYYTIVKEILGEEWLNNRLFRLGTSRLANLLL 289 Lambda K H 0.317 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 300 Length adjustment: 26 Effective length of query: 233 Effective length of database: 274 Effective search space: 63842 Effective search space used: 63842 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate 352790 BT3263 (putative deoxyribose-phosphate aldolase (NCBI ptt file))
to HMM TIGR00126 (deoC: deoxyribose-phosphate aldolase (EC 4.1.2.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00126.hmm # target sequence database: /tmp/gapView.23572.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00126 [M=211] Accession: TIGR00126 Description: deoC: deoxyribose-phosphate aldolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-53 168.0 1.8 1.4e-53 167.5 1.8 1.2 1 lcl|FitnessBrowser__Btheta:352790 BT3263 putative deoxyribose-phos Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:352790 BT3263 putative deoxyribose-phosphate aldolase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 167.5 1.8 1.4e-53 1.4e-53 4 205 .. 53 271 .. 50 276 .. 0.94 Alignments for each domain: == domain 1 score: 167.5 bits; conditional E-value: 1.4e-53 TIGR00126 4 kliDhtalkadtteedietlcaeAkky........kfaavcvnpsyvslAkelLkgteveictvv.gFPlGastte 70 + iD+t+l++ + +e + + ++ ++ ++aa+cv+p++ ++ k++L+ ++i++v gFP+ ++ +e lcl|FitnessBrowser__Btheta:352790 53 NCIDLTTLNSTDSDESVMHFTEKVNEFdnefpdmkNVAAICVYPNFADIVKNTLQVDGINIACVSgGFPSSQTFIE 128 78****************9999988776667777789***************************846********* PP TIGR00126 71 vkllEakeaieeGAdEvDvviniaalkdkneevviedikavveacakvllKvilEtalLtd.eekkkAseisieag 145 vk++E+ ai+ GAdE+D+vi i+++ +++ e+ e+i+ ++e+c +++lKvilEt+ L+ +++kkAs +s+ +g lcl|FitnessBrowser__Btheta:352790 129 VKVAETALAIADGADEIDIVISIGKFLSGDYETMCEEIQELKEVCKERHLKVILETGALKTaSNIKKASILSMYSG 204 **********************************************************97626777********** PP TIGR00126 146 adfvKtstgfsakgAtvedvrlmkkvvgd.......evgvKasGGvrtaedalalieagaerigasa 205 adf+Ktstg+++ At+e + +m +++++ ++g+K++GG+ t+ da+ + + e +g ++ lcl|FitnessBrowser__Btheta:352790 205 ADFIKTSTGKQQPAATPEAAYVMCEAIKEyyqktnnKIGFKPAGGINTVHDAIIYYTIVKEILGEEW 271 ****************************99999999**********************999999877 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (211 nodes) Target sequences: 1 (300 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 8.46 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory