Align Carbamate kinase; EC 2.7.2.2 (characterized, see rationale)
to candidate 3607013 Dshi_0434 carbamate kinase (RefSeq)
Query= uniprot:P13982 (310 letters) >FitnessBrowser__Dino:3607013 Length = 312 Score = 318 bits (816), Expect = 8e-92 Identities = 176/301 (58%), Positives = 212/301 (70%), Gaps = 3/301 (0%) Query: 1 MRIVVALGGNALLRRGEPMTADNQRENVRIAAEQIAKVA-PGNELVIAHGNGPQVGLLAL 59 M +V ALGGNALL+RGEP+TA+NQR NVR AA +A++ G+ LV+ HGNGPQVGLLAL Sbjct: 1 MLVVAALGGNALLKRGEPLTAENQRRNVREAAVALARIVRAGHRLVVTHGNGPQVGLLAL 60 Query: 60 QGAAYDKVSPYPLDVLGAETEGMIGYMIEQEMGNLLPFEVPFATILTQVEVDGKDPAFQN 119 QGAAY YPLDVLGAET GMIGY+IEQE+ N L + AT+LTQ+ VD D AF++ Sbjct: 61 QGAAYKPEEAYPLDVLGAETGGMIGYIIEQELENALDHDRAVATLLTQIVVDPDDLAFRD 120 Query: 120 PTKPIGPVYSREEAERLAAEKGWSIAPDGDKFRRVVPSPRPKRIFEIRPVKWLLEKGTIV 179 P K IGPVYSR+EAE A GW+IA DGDK+RRVVPSP P+ I ++R ++ LLE+ IV Sbjct: 121 PAKFIGPVYSRDEAEARAKAVGWTIAQDGDKWRRVVPSPAPQEIPDMRVIRMLLEQDVIV 180 Query: 180 ICAGGGGIPTMYDEAGKKLSGVEAVIDKDLCSSLLAQELVADILIIATDVDAAYVDWGKP 239 IC GGGGIP + A L G+EAVIDKD S+LLA+EL AD L++ TDVD Y D+G Sbjct: 181 ICGGGGGIPVL-RRADGSLIGIEAVIDKDAASALLARELEADALLLLTDVDGVYRDFGTD 239 Query: 240 TQKAIAQAHPDELERLGFAAGSMGPKVQAAIEFARATGKDAVIGSLADIVAITEGKAGTR 299 Q I P E +L AGSMGPK+ AA FA A G A IG L + I EG+AGTR Sbjct: 240 RQARIDSLTPGEAFKLNLPAGSMGPKMLAAARFA-AYGGLAGIGRLDEATDILEGRAGTR 298 Query: 300 V 300 V Sbjct: 299 V 299 Lambda K H 0.317 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 312 Length adjustment: 27 Effective length of query: 283 Effective length of database: 285 Effective search space: 80655 Effective search space used: 80655 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate 3607013 Dshi_0434 (carbamate kinase (RefSeq))
to HMM TIGR00746 (arcC: carbamate kinase (EC 2.7.2.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00746.hmm # target sequence database: /tmp/gapView.6280.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00746 [M=309] Accession: TIGR00746 Description: arcC: carbamate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-116 372.7 0.0 7.2e-116 372.5 0.0 1.0 1 lcl|FitnessBrowser__Dino:3607013 Dshi_0434 carbamate kinase (RefS Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3607013 Dshi_0434 carbamate kinase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 372.5 0.0 7.2e-116 7.2e-116 3 308 .. 3 300 .. 1 301 [. 0.97 Alignments for each domain: == domain 1 score: 372.5 bits; conditional E-value: 7.2e-116 TIGR00746 3 vvvaLGGnallqrgekasaeeqrknvekaakqlvklakrgyelvithGngPqvGalllqneaadsvpakPldvlgae 79 vv aLGGnall+rge ++ae+qr+nv++aa +l++++++g++lv+thGngPqvG l+lq +a++ +a+Pldvlgae lcl|FitnessBrowser__Dino:3607013 3 VVAALGGNALLKRGEPLTAENQRRNVREAAVALARIVRAGHRLVVTHGNGPQVGLLALQGAAYKPEEAYPLDVLGAE 79 7999************************************************************************* PP TIGR00746 80 sqgliGYllqqalkeelakeglekkvatvltqvivdekDeaFqnPtkpigpfydeeeakrlaaekgailkedagrgw 156 + g+iGY+++q+l+++l + vat+ltq++vd++D aF++P k+igp+y+++ea++ a++ g+++++ +g++w lcl|FitnessBrowser__Dino:3607013 80 TGGMIGYIIEQELENALD---HDRAVATLLTQIVVDPDDLAFRDPAKFIGPVYSRDEAEARAKAVGWTIAQ-DGDKW 152 *****************9...899**********************************************9.9**** PP TIGR00746 157 RrvvpsPkPkeiveaeviktLvekgvivissgGGGvPvvkd.gkelkGveaviDkDlasekLaeevnaDilviltdv 232 RrvvpsP P+ei +++vi++L+e++vivi+ gGGG+Pv + + +l G+eaviDkD as++La+e++aD+l++ltdv lcl|FitnessBrowser__Dino:3607013 153 RRVVPSPAPQEIPDMRVIRMLLEQDVIVICGGGGGIPVLRRaDGSLIGIEAVIDKDAASALLARELEADALLLLTDV 229 **************************************9761556******************************** PP TIGR00746 233 davyvnygkpdekkleevkveeleelakdgefaaGsmgPkveaaiefvesrgkkaiitslekivealegkaGtvvv 308 d vy+++g++ + ++ +++ e+ +l+ aGsmgPk+ aa +f+ +g a i++l++++++leg aGt+v+ lcl|FitnessBrowser__Dino:3607013 230 DGVYRDFGTDRQARIDSLTPGEAFKLN----LPAGSMGPKMLAAARFAAYGG-LAGIGRLDEATDILEGRAGTRVI 300 **************************9....9***************97766.7899*****************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (312 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.72 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory