Align Phosphate acetyltransferase; EC 2.3.1.8; Phosphotransacetylase (uncharacterized)
to candidate 3607217 Dshi_0633 Phosphate butyryltransferase (RefSeq)
Query= curated2:Q9X448 (316 letters) >FitnessBrowser__Dino:3607217 Length = 471 Score = 315 bits (808), Expect = 1e-90 Identities = 169/292 (57%), Positives = 208/292 (71%) Query: 12 YDRLIAAARAEAPAVTIVAHPCDETSLGGAIEAAEMGLITPILVAPEAKIRNVAAEHRLD 71 ++R+I A P T V P + +L G I AE LITP+L+ +I AAE +D Sbjct: 174 FERMILRAEPLPPFPTAVVAPEEPDALAGTILGAEHTLITPLLIGDPDRIAAAAAEKGID 233 Query: 72 LGRREIVDVPHSHAAAAKAVALIREGRGELLMKGSLHTDELMHEVAASATGLRTQRRISH 131 L EI+ PH AAAA AV L+ EGR + +MKG LHTD L+ + GLR RR+SH Sbjct: 234 LAPYEIIAEPHHKAAAACAVRLVHEGRAKAIMKGHLHTDVLLSAILKKDGGLRGTRRLSH 293 Query: 132 VFVMDVPGHTDTLFITDAAINIFPDLEAKRDIVQNAIDLWVAIGLGEPRVAILSAVETVT 191 VFVMDVPG LFI+DAAINI PDL+ K DI QNAIDL +AIG+ P+V ILSAVETV Sbjct: 294 VFVMDVPGLDHPLFISDAAINIAPDLKTKADITQNAIDLALAIGVTMPKVGILSAVETVN 353 Query: 192 AKIPSTIEAAALCKMAERGQITGGVLEGPLAFDNAIDQEAARIKGINSPVAGHAQILVVP 251 IPST++AA L KMAERGQITGG+++GPLA DNA+D AAR KGI S VAG A IL+VP Sbjct: 354 PAIPSTLDAAILSKMAERGQITGGLVDGPLAMDNAVDLAAARTKGIISKVAGQADILIVP 413 Query: 252 DLEAGNMLAKNLTFLTHADAAGLVLGARVPIVLTSRADSVRTRLASCAVAAL 303 ++EAGNMLAK LT+L HADA G+V+GA+ P++L SRAD+ + RLASCA+AAL Sbjct: 414 NMEAGNMLAKQLTYLAHADAGGIVMGAQCPVILNSRADNDKARLASCAIAAL 465 Lambda K H 0.320 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 471 Length adjustment: 30 Effective length of query: 286 Effective length of database: 441 Effective search space: 126126 Effective search space used: 126126 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory