Align [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase (EC 2.5.1.113); O-phosphoserine sulfhydrylase (EC 2.5.1.65) (characterized)
to candidate 3607478 Dshi_0891 cysteine synthase A (RefSeq)
Query= BRENDA::P9WP53 (323 letters) >FitnessBrowser__Dino:3607478 Length = 360 Score = 168 bits (425), Expect = 2e-46 Identities = 115/338 (34%), Positives = 162/338 (47%), Gaps = 41/338 (12%) Query: 4 YDSLLQALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQAE 63 YDS+L +GNTP++ + L+P V L+ K E NP S+KDR A+ +IE AE Sbjct: 17 YDSVLDTVGNTPVIRINNLAPEG--------VELYVKAEFFNPAASVKDRLALNIIEAAE 68 Query: 64 ADGLLRPGATILEPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQIIFS 123 G L+PG T++E TSGNTGI LAM KGY L+ M E+ S+ERR+L+ L GA+++ + Sbjct: 69 RAGTLKPGQTVVEATSGNTGIGLAMVCAQKGYPLVITMAESFSIERRKLMRLLGAKVVLT 128 Query: 124 AAEGGSNTAVATAKELAATNPSWVMLYQYGNPANTDSHYCGTGPELLADLP--EITHFVA 181 A ELA N W + Q+ AN + H T E+L D ++ + V Sbjct: 129 PRAEKGFGMYRKAVELAEAN-GWFLASQFETAANAEMHENTTAQEILGDFEGCKLDYIVT 187 Query: 182 GLGTTGTLMGTGRFLREHVANVKIVAAEPR----YGEGV-------------------YA 218 G GT GT+ G GR LR+ KI+ EP G G+ + Sbjct: 188 GYGTGGTVTGLGRVLRKARPETKIILTEPANAQLLGSGIAQDRDPNGAPAVSHSAFEPHP 247 Query: 219 LRNMDEGFVP----ELYDPEILTARYSVGAVDAVRRTRELVHTEGIFAGISTGAVLHAAL 274 ++ F+P E D A V D + R L EGI GIS G+ + Sbjct: 248 IQGWTPDFIPKVLQESIDQGFYDALLPVAGADGIAWARRLAAEEGILTGISGGSTFAISH 307 Query: 275 GVGAGALAAGERADIALVVADAGWKYLSTGAYAGSLDD 312 V A A E + I ++ D G +YLST + G ++D Sbjct: 308 EV---AKTAPEGSVILCMLPDTGERYLSTPLFEGIVED 342 Lambda K H 0.317 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 360 Length adjustment: 29 Effective length of query: 294 Effective length of database: 331 Effective search space: 97314 Effective search space used: 97314 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory