Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate 3608351 Dshi_1753 Enoyl-CoA hydratase/isomerase (RefSeq)
Query= BRENDA::Q9LKJ1 (378 letters) >FitnessBrowser__Dino:3608351 Length = 258 Score = 67.0 bits (162), Expect = 5e-16 Identities = 53/194 (27%), Positives = 85/194 (43%), Gaps = 8/194 (4%) Query: 7 SQSQVLVEEKSSVRILTLNRPKQLNALSFHMISRLLQLF-LAFEEDPSVKLVILKGHGRA 65 S + + + +LTLNRP +NAL+ M + + LA E +++++ G GRA Sbjct: 2 SYQTITLTIEDDAAVLTLNRPDVMNALNSQMRAEITDAVKLAGAE---ARVLVMTGAGRA 58 Query: 66 FCAGGDVAAVVRDINQGNWRLGANYFSSEYMLNYVMATYSKAQVSILNGIVMGGGAGVSV 125 FC+G D+ N N L + + ++ +NG G GA +++ Sbjct: 59 FCSGQDLGDRA---NAANLDLERTLRDEYVPMLRAIFDCPVPTIAAVNGPAAGAGANLAL 115 Query: 126 HGRFRIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEY-VGLTGARLDGAEMLACG 184 IATE+ VF T +GL PD G +Y+L R GF L ++ + A G Sbjct: 116 AADVVIATESAVFLQAFTRIGLIPDAGGTYWLPRQMGFAKAMGAALFADKITARQADAWG 175 Query: 185 LATHFVPSTRLTAL 198 + VP A+ Sbjct: 176 MIWEAVPDAEFEAV 189 Lambda K H 0.321 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 258 Length adjustment: 27 Effective length of query: 351 Effective length of database: 231 Effective search space: 81081 Effective search space used: 81081 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory