Align serine O-acetyltransferase (EC 2.3.1.30) (characterized)
to candidate 3608769 Dshi_2161 serine O-acetyltransferase (RefSeq)
Query= BRENDA::C4IRW0 (281 letters) >FitnessBrowser__Dino:3608769 Length = 269 Score = 298 bits (764), Expect = 7e-86 Identities = 143/267 (53%), Positives = 185/267 (69%) Query: 15 KVNAGLDQVDPIWHSIRAEAEEATRNDPVLGAFLYATILNQPSLEEAVMHRIAERLGHPD 74 K + L VDP+WH I EA A ++ +LG ++++IL+ + E A+ +RI +L P+ Sbjct: 3 KASKSLKAVDPVWHRIGEEARLAVADEQLLGGLVHSSILHHATFEAALAYRITLKLSSPE 62 Query: 75 VSADILRQTFDTMLEANPEWSHVLRVDIQAVYDRDPAYSRFMDPVLYLKGFHAIQTHRLA 134 +SA LRQ D ++ R D+ AVY+RDPA R M P+LY KGF A+Q +R+ Sbjct: 63 MSAQTLRQLVDDAFASDATLGVAARADLVAVYERDPACHRLMQPLLYFKGFQAVQAYRVG 122 Query: 135 HWLYKQGRKDFAYYLQSRSSSIFQTDIHPAARLGSGLFLDHATGLVVGETAVVEDNVSIL 194 HWLY QGR D AY++Q R S +F DIHPAA++G G+ +DHA +V+GETAVV DNVS+L Sbjct: 123 HWLYSQGRHDLAYFVQMRVSEVFGVDIHPAAKIGQGIMIDHAHSIVIGETAVVGDNVSML 182 Query: 195 HGVTLGGTGKSSGDRHPKIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVA 254 H VTLGGTGK DRHPKI GVLIGAGA +LGNI +G CS+IAAGSVVL VP TVA Sbjct: 183 HSVTLGGTGKEDDDRHPKIGDGVLIGAGAHVLGNITIGHCSRIAAGSVVLSDVPPCKTVA 242 Query: 255 GVPARIIGETGCTEPSRVMDQMLGDGI 281 GVPA+I+GE GC +PS MDQ+L + I Sbjct: 243 GVPAKIVGEAGCAQPSVTMDQLLSESI 269 Lambda K H 0.320 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 269 Length adjustment: 25 Effective length of query: 256 Effective length of database: 244 Effective search space: 62464 Effective search space used: 62464 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate 3608769 Dshi_2161 (serine O-acetyltransferase (RefSeq))
to HMM TIGR01172 (cysE: serine O-acetyltransferase (EC 2.3.1.30))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01172.hmm # target sequence database: /tmp/gapView.7794.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01172 [M=162] Accession: TIGR01172 Description: cysE: serine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-71 225.5 2.3 1.7e-71 225.5 2.3 1.6 2 lcl|FitnessBrowser__Dino:3608769 Dshi_2161 serine O-acetyltransfe Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3608769 Dshi_2161 serine O-acetyltransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.13 0.13 21 42 .. 39 60 .. 35 77 .. 0.75 2 ! 225.5 2.3 1.7e-71 1.7e-71 2 162 .] 87 247 .. 86 247 .. 0.99 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.13 TIGR01172 21 vlllykglhallayrlahalyk 42 +l ++++ a layr++ +l + lcl|FitnessBrowser__Dino:3608769 39 SILHHATFEAALAYRITLKLSS 60 5788899999999999887755 PP == domain 2 score: 225.5 bits; conditional E-value: 1.7e-71 TIGR01172 2 kedlkavlerDPaaesalevlllykglhallayrlahalykrklkllarllselvrvltgvdihPaakigrgvliDh 78 ++dl av+erDPa+++ +++ll++kg++a++ayr+ h+ly+++++ la++++ +v+ ++gvdihPaakig+g++iDh lcl|FitnessBrowser__Dino:3608769 87 RADLVAVYERDPACHRLMQPLLYFKGFQAVQAYRVGHWLYSQGRHDLAYFVQMRVSEVFGVDIHPAAKIGQGIMIDH 163 6899************************************************************************* PP TIGR01172 79 atGvviGetavigddvsiyqgvtLGgtgkekgkRhPtvkegvvigagakvLGnievgenakiGansvvlkdvpaeat 155 a+ +viGetav+gd+vs++++vtLGgtgke +RhP++++gv+igaga+vLGni++g+ ++i a+svvl+dvp+ t lcl|FitnessBrowser__Dino:3608769 164 AHSIVIGETAVVGDNVSMLHSVTLGGTGKEDDDRHPKIGDGVLIGAGAHVLGNITIGHCSRIAAGSVVLSDVPPCKT 240 ***************************************************************************** PP TIGR01172 156 vvGvpar 162 v+Gvpa+ lcl|FitnessBrowser__Dino:3608769 241 VAGVPAK 247 *****97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (162 nodes) Target sequences: 1 (269 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 6.68 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory