Align diaminopimelate decarboxylase (EC 4.1.1.20) (characterized)
to candidate 3609676 Dshi_3059 diaminopimelate decarboxylase (RefSeq)
Query= reanno::Korea:Ga0059261_2051 (419 letters) >FitnessBrowser__Dino:3609676 Length = 431 Score = 412 bits (1058), Expect = e-119 Identities = 217/422 (51%), Positives = 280/422 (66%), Gaps = 5/422 (1%) Query: 1 MDHFNRKNGVLHAENVSIPAIAAEVGTPVYVYSTATLERHASALKNALAGLPSVHLAFAI 60 MDHF G LHAE+V + AIA VGTP YVYSTATL RH AL+ P + + FA+ Sbjct: 1 MDHFTYIKGQLHAEDVPVSAIADAVGTPFYVYSTATLTRHFKLFDEALSWGPHL-VCFAM 59 Query: 61 KANPNLAVLGVLARQGYGADVVSGGELKRALAAGMPAEDVVFSGVGKTRAELQLGLDEGI 120 K+N N A+L +LA G G DVVSGGE RA AAG+P + +VFSGVGKT E+++ L GI Sbjct: 60 KSNSNQAILKLLADLGAGMDVVSGGEYARARAAGVPGDRIVFSGVGKTADEMRMALTGGI 119 Query: 121 GQFNLELEEEGEVLADLAHAQGKTAPAVLRVNPDVDAGTHAKISTGKAENKFGVAIDRAL 180 QFN+E E E + L+ +A G AP +RVNPDVDA TH KI+TGK+ENKFG+ I RA Sbjct: 120 RQFNVESEPEMQRLSAVAQGLGMQAPITIRVNPDVDAKTHEKIATGKSENKFGIPISRAR 179 Query: 181 EIFDRLAKRPGLNLRGVAIHIGSQLTELAPLEAAYKRVGELVAQLRAAGHTITHVDLGGG 240 E++ + A+ PG+ + G+ +HIGSQLTEL P E AY +V EL LRA GH IT +DLGGG Sbjct: 180 EVYAQAARLPGIKVIGIDVHIGSQLTELEPFELAYAKVAELTRHLRADGHEITRLDLGGG 239 Query: 241 LGVPY-HAGQTVSTAEEFGAMVARVTQGWNVTLMFEPGRFICGNAGVLVTEVIWVKPAAG 299 LG+PY + ++GA++ R + EPGR I GNAG+LV+EVI+VK Sbjct: 240 LGIPYARTNEAPPLPTDYGALIQRTVGDLGCEIEIEPGRLISGNAGLLVSEVIYVKQGED 299 Query: 300 NPYVIVDAAMNDLARPALYDAYHEFEAVE---PTGEKFVANIAGPVCETGDTFAMGREID 356 ++I+DAAMNDL RP++Y AYH+ V P +I GPVCE+GDTFA RE+ Sbjct: 300 RQFLILDAAMNDLIRPSMYGAYHDIVPVREAAPGTPTTPYDIVGPVCESGDTFAKSREMV 359 Query: 357 VVKSGDLAVFRTAGAYGATMASTYNSRALVPEVLVSGDRFAVVADRIQPETIMGAERVPE 416 + GDL FR+AGAYGA MAS YN+R L+PEVLV GD+FAV+ R + I+ + +P Sbjct: 360 PLTEGDLVAFRSAGAYGAVMASEYNTRPLIPEVLVHGDQFAVIRQRPSFDEIINRDTIPA 419 Query: 417 WV 418 W+ Sbjct: 420 WL 421 Lambda K H 0.318 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 542 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 419 Length of database: 431 Length adjustment: 32 Effective length of query: 387 Effective length of database: 399 Effective search space: 154413 Effective search space used: 154413 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate 3609676 Dshi_3059 (diaminopimelate decarboxylase (RefSeq))
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.5124.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-147 477.7 0.0 1.4e-147 477.4 0.0 1.0 1 lcl|FitnessBrowser__Dino:3609676 Dshi_3059 diaminopimelate decarb Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3609676 Dshi_3059 diaminopimelate decarboxylase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 477.4 0.0 1.4e-147 1.4e-147 6 416 .. 8 415 .. 4 416 .. 0.96 Alignments for each domain: == domain 1 score: 477.4 bits; conditional E-value: 1.4e-147 TIGR01048 6 dgeleiegvdlkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllaeeGlgldvvsgG 82 +g+l +e+v++ ++a+ gtP+Yvy+++tl+++++ ++ea + +lv++A+K+nsn a+l+lla++G+g+dvvsgG lcl|FitnessBrowser__Dino:3609676 8 KGQLHAEDVPVSAIADAVGTPFYVYSTATLTRHFKLFDEALSWGPHLVCFAMKSNSNQAILKLLADLGAGMDVVSGG 84 799***************************************999******************************** PP TIGR01048 83 EleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgkkarvllRvnpdvdakthey 159 E +ra aAgv+ ++ivfsg+gk+ +e+++al+ +i+ +nv+s+ e+++l+++a++lg++a++++Rvnpdvdakthe+ lcl|FitnessBrowser__Dino:3609676 85 EYARARAAGVPGDRIVFSGVGKTADEMRMALTGGIRQFNVESEPEMQRLSAVAQGLGMQAPITIRVNPDVDAKTHEK 161 ***************************************************************************** PP TIGR01048 160 isTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfveaaekvvklleelkeegieleeldlGG 236 i+TG+ e+KFGi +++a+e+y +a++l+ ++++Gi+vHIGSq+++lepf+ a +kv++l+++l+++g e++ ldlGG lcl|FitnessBrowser__Dino:3609676 162 IATGKSENKFGIPISRAREVYAQAARLPGIKVIGIDVHIGSQLTELEPFELAYAKVAELTRHLRADGHEITRLDLGG 238 ***************************************************************************** PP TIGR01048 237 Glgisyeeeeea.pdleeyaeklleklekeaelglklklilEpGRslvanagvlltrVesvKevesrkfvlvDagmn 312 Glgi+y + +ea p +++y + + +++ + l ++ +EpGR + +nag l+ +V +vK+ e r+f + Da+mn lcl|FitnessBrowser__Dino:3609676 239 GLGIPYARTNEApPLPTDYGALIQRTVGD-----LGCEIEIEPGRLISGNAGLLVSEVIYVKQGEDRQFLILDAAMN 310 ******98766505578888888877777.....799**************************************** PP TIGR01048 313 dliRpalYeayheiaalkr.leeeetetvdvvGplCEsgDvlakdrelpeveeGdllavasaGAYgasmssnYnsrp 388 dliRp++Y+ayh+i+++++ ++t+ +d+vGp+CEsgD++ak re+ eGdl+a +saGAYga m+s+Yn+rp lcl|FitnessBrowser__Dino:3609676 311 DLIRPSMYGAYHDIVPVREaAPGTPTTPYDIVGPVCESGDTFAKSREMVPLTEGDLVAFRSAGAYGAVMASEYNTRP 387 *****************8835578999************************************************** PP TIGR01048 389 rpaevlveegkarlirrretledllale 416 + evlv++++ +ir+r +++++++ + lcl|FitnessBrowser__Dino:3609676 388 LIPEVLVHGDQFAVIRQRPSFDEIINRD 415 ************************9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (431 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.48 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory