Align Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 (characterized)
to candidate 7023157 Shewana3_0391 diaminopimelate epimerase (RefSeq)
Query= SwissProt::P0A6K1 (274 letters) >FitnessBrowser__ANA3:7023157 Length = 275 Score = 394 bits (1012), Expect = e-114 Identities = 189/274 (68%), Positives = 217/274 (79%) Query: 1 MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHY 60 +QF+KMHGLGNDFMVVD VTQNVFFSPE IRRLADR+ G+GFDQLL+VEPPYDP+LDFHY Sbjct: 2 IQFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLDFHY 61 Query: 61 RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMGE 120 RIFNADG EV CGNGARCFARFVR KGLTNK IRVST+ G+M L + D V VNMG Sbjct: 62 RIFNADGGEVENCGNGARCFARFVRNKGLTNKNKIRVSTSAGKMTLRLERDGTVTVNMGV 121 Query: 121 PNFEPSAVPFRANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLE 180 P +PS +PF+A KAEKTY+++ +QT LCG SMGNPHCV+ V+DV A V +G +L Sbjct: 122 PVLDPSQIPFKAKKAEKTYLLQTPQQTFLCGAASMGNPHCVLDVEDVANANVAEIGALLT 181 Query: 181 SHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGLLAEEVRV 240 HERFP N+GFMQVV HI+LRVYERGA ET ACG+GACAAV VG QG L ++VRV Sbjct: 182 KHERFPRGVNVGFMQVVNSGHIKLRVYERGAAETLACGTGACAAVVVGQIQGKLDQQVRV 241 Query: 241 ELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 274 +LPGG L I W+G G PL+MTGPA HVYDG I L Sbjct: 242 DLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL 275 Lambda K H 0.323 0.140 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 275 Length adjustment: 25 Effective length of query: 249 Effective length of database: 250 Effective search space: 62250 Effective search space used: 62250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.7 bits)
Align candidate 7023157 Shewana3_0391 (diaminopimelate epimerase (RefSeq))
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00652.hmm # target sequence database: /tmp/gapView.11651.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00652 [M=270] Accession: TIGR00652 Description: DapF: diaminopimelate epimerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-102 326.7 0.0 6.5e-102 326.5 0.0 1.0 1 lcl|FitnessBrowser__ANA3:7023157 Shewana3_0391 diaminopimelate ep Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__ANA3:7023157 Shewana3_0391 diaminopimelate epimerase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 326.5 0.0 6.5e-102 6.5e-102 1 269 [. 2 274 .. 2 275 .] 0.96 Alignments for each domain: == domain 1 score: 326.5 bits; conditional E-value: 6.5e-102 TIGR00652 1 meFlkmhGlgNdFvlvdevdeelvkeeaelvrkvcdrhtgvgaDgvllvep.sseeadvklrifNsDGSeaemCGNg 76 ++F+kmhGlgNdF++vd v+++++++ +e++r+++dr++g+g+D++llvep ++++ d+++rifN+DG e+e+CGNg lcl|FitnessBrowser__ANA3:7023157 2 IQFTKMHGLGNDFMVVDGVTQNVFFS-PEQIRRLADRNFGIGFDQLLLVEPpYDPDLDFHYRIFNADGGEVENCGNG 77 69***********************9.9**********************999************************ PP TIGR00652 77 iRcfakfvyekglkekkelsvetlaglikveveeenkkvkvdmgepkfkkeeipltvekeeekeellalev..l... 148 +Rcfa+fv++kgl++k++++v+t ag++++ +e+++ +v+v+mg p + +++ip++++k+e+ ++ll++ + lcl|FitnessBrowser__ANA3:7023157 78 ARCFARFVRNKGLTNKNKIRVSTSAGKMTLRLERDG-TVTVNMGVPVLDPSQIPFKAKKAEK-TYLLQTPQqtFlcg 152 ************************************.********************99888.55555554453579 PP TIGR00652 149 vvdvGnPHlvvfvedvekldleelgklleaheefpegvNvefvevkkedeiklrvyERGageTlaCGtGavAsavva 225 + ++GnPH+v+ vedv ++++ e+g+ll +he+fp gvNv f++v+++ +iklrvyERGa eTlaCGtGa+A++vv+ lcl|FitnessBrowser__ANA3:7023157 153 AASMGNPHCVLDVEDVANANVAEIGALLTKHERFPRGVNVGFMQVVNSGHIKLRVYERGAAETLACGTGACAAVVVG 229 ***************************************************************************** PP TIGR00652 226 lklgktkkkvtvhleggeLeievkedg.kvyltGpavlvlegela 269 +gk++++v+v l+gg L+i+++ +g +++tGpa++v++g+++ lcl|FitnessBrowser__ANA3:7023157 230 QIQGKLDQQVRVDLPGGTLTINWEGEGkPLWMTGPAQHVYDGQIQ 274 ***************************99*************975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (275 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 7.41 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory