Align Aminomethyltransferase; EC 2.1.2.10; Glycine cleavage system T protein (uncharacterized)
to candidate 8499572 DvMF_0341 glycine cleavage system T protein (RefSeq)
Query= curated2:Q31KT1 (372 letters) >FitnessBrowser__Miya:8499572 Length = 362 Score = 257 bits (657), Expect = 3e-73 Identities = 162/363 (44%), Positives = 209/363 (57%), Gaps = 19/363 (5%) Query: 9 LLSSPLHSVCTSAGARFTGFAGWELPLQFQ-GLMQEHLAVRERAGLFDISHMGKFQLRGS 67 LL +PL + +AGA+ FAGW++P+Q+ G++ EH+ RE A LFDI HMG+F LRG Sbjct: 4 LLQTPLSAWHRAAGAKMAPFAGWDMPIQYPTGIIAEHVQTRESAALFDICHMGEFTLRGP 63 Query: 68 GLRAALQRLLPSDLTTLLPGQAQYSVLLNEAGGCLDDLIVYWQGIVDGVEQAFLIVNAAT 127 G R AL R + +L TL PG+ +Y LLNEAGG LDDLIVY + L+VN A Sbjct: 64 GARDALSRAVSHNLETLKPGRCRYGFLLNEAGGILDDLIVY----CVAEDDYMLVVNGAC 119 Query: 128 TDSDRLWLTEHLPPAIALLDLSQDLALVAIQGPQAIAFLQPLVSCDLAELPRFSHTVTSI 187 T+SD L LP + D+S A + +QGP++ L+ ++ +LP F Sbjct: 120 TESDFAALRSRLPAVLPFEDISARTAKLDLQGPKSFDVLEAVLGESFRDLPYFGFRSVVF 179 Query: 188 AGQPAFVARTGYTGEDGCEVMLPPAAAITLWQQLTA-AGVVPCGLGARDTLRLEAAMPLY 246 G P V+RTGYTGE G E+ LP A LW L A V P GLGARDTLRLE +PLY Sbjct: 180 GGAPLLVSRTGYTGELGVELYLPWDKAEALWTALLADERVKPAGLGARDTLRLEVGLPLY 239 Query: 247 GHELDTDTNPLEAGLGWVVHLDRNPDFLGR--DRLVQAKTNGLERRLVGLELPGRNIARH 304 GH+LD P EAG G + L D++G+ DR V+ LV L +PGR ARH Sbjct: 240 GHDLDDTHTPAEAGYGGM--LTNPADYVGKGADREVR-------EPLVALSIPGRRSARH 290 Query: 305 GYPVAIADTTV-GIVTSGSWSPTLSKAIALAYVPPALANLGQELWVEIRGKQVPATVVKR 363 G VA+ D TV G+VTSGS+ P+L A+ALA V A A V+ ++ AT V Sbjct: 291 GDVVALPDGTVAGVVTSGSFCPSLGYAVALARVAAAHAE-APTFVVKAAKVELEATRVAL 349 Query: 364 PFY 366 PFY Sbjct: 350 PFY 352 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 17 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 372 Length of database: 362 Length adjustment: 30 Effective length of query: 342 Effective length of database: 332 Effective search space: 113544 Effective search space used: 113544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate 8499572 DvMF_0341 (glycine cleavage system T protein (RefSeq))
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.19946.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-86 276.9 0.0 1.3e-86 276.7 0.0 1.0 1 lcl|FitnessBrowser__Miya:8499572 DvMF_0341 glycine cleavage syste Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8499572 DvMF_0341 glycine cleavage system T protein (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 276.7 0.0 1.3e-86 1.3e-86 2 343 .. 5 335 .. 4 354 .. 0.93 Alignments for each domain: == domain 1 score: 276.7 bits; conditional E-value: 1.3e-86 TIGR00528 2 krtpLydlhtelggklvdfaGwelPvqy.kslieeheavrtkaGlfDvshmgkvelsGskslkfLqrllanDvdaLt 77 +tpL h g+k+ +faGw +P+qy +++i eh +r++a lfD+ hmg+++l+G+ ++++L r ++ +++ L lcl|FitnessBrowser__Miya:8499572 5 LQTPLSAWHRAAGAKMAPFAGWDMPIQYpTGIIAEHVQTRESAALFDICHMGEFTLRGPGARDALSRAVSHNLETLK 81 69**************************5578********************************************* PP TIGR00528 78 kGkaqysvllnaqGGvvDDlivykegednrfllvvnaataekDlewlkehleeevtldtlskeisllalqGPkakti 154 +G+ +y lln GG++DDlivy +ed ++lvvn a++e D + l+ +l+ ++++s + l lqGPk+ ++ lcl|FitnessBrowser__Miya:8499572 82 PGRCRYGFLLNEAGGILDDLIVYCVAED-DYMLVVNGACTESDFAALRSRLPAVLPFEDISARTAKLDLQGPKSFDV 157 ****************************.9*********************************************** PP TIGR00528 155 ledlldkaveglkefffvqeaelalkkaliartGytGedGfeiavanekavelwkklveaygvkPiGLgarDtLrle 231 le +l ++ +l+ f+f + + l++rtGytGe G e++++ +ka lw +l+++ vkP GLgarDtLrle lcl|FitnessBrowser__Miya:8499572 158 LEAVLGESFRDLPYFGFR-SVVFGGAPLLVSRTGYTGELGVELYLPWDKAEALWTALLADERVKPAGLGARDTLRLE 233 *************99998.778888888************************************************* PP TIGR00528 232 agmaLyGqeldeeitPleaglgwvvkkerkksdfiGravleeqkengtekklvGlemlekgiarnelkvlltngeke 308 g++LyG++ld++ tP eag g +++ d++G+ + + ++++ lv l + + ar++ v l++g + lcl|FitnessBrowser__Miya:8499572 234 VGLPLYGHDLDDTHTPAEAGYGGMLTNP---ADYVGKGA-----DREVREPLVALSIPGRRSARHGDVVALPDG-TV 301 **********************999877...899**986.....4556677***********************.** PP TIGR00528 309 vGivtsGtlsPtLgknialayvdkelekiGtklev 343 G+vtsG++ P Lg+++ala+v ++ t v lcl|FitnessBrowser__Miya:8499572 302 AGVVTSGSFCPSLGYAVALARVAAAHAEAPT-FVV 335 **********************976665544.334 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (362 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.99 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory