Align purine-nucleoside phosphorylase (EC 2.4.2.1) (characterized)
to candidate 8500058 DvMF_0821 purine nucleoside phosphorylase (RefSeq)
Query= BRENDA::P00491 (289 letters) >FitnessBrowser__Miya:8500058 Length = 281 Score = 236 bits (602), Expect = 4e-67 Identities = 125/259 (48%), Positives = 169/259 (65%), Gaps = 7/259 (2%) Query: 24 RPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQG 83 RP+V ++CG+GLGGL D L A+ Y +P FP+STV H GR +FG + V+ QG Sbjct: 30 RPRVGVVCGTGLGGLADALADARPLPYSRVPGFPQSTVASHEGRFLFGRIGTVEVVLQQG 89 Query: 84 RFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG 143 R H+YEGY V VRV LGV+ LV+TNAAG LNP+++ GD+MLI DHIN F+G Sbjct: 90 RCHLYEGYAPEDVCMGVRVMAALGVEMLVITNAAGALNPRWDAGDLMLITDHIN---FTG 146 Query: 144 QNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETV 203 ++PL GPN + +G RFP MS YD T+ + A+ ++G + L+ G YV V GP ET Sbjct: 147 RSPLTGPNHDAWGPRFPDMSAPYDATLGRIAMEEAARLGVR--LERGVYVGVPGPQMETP 204 Query: 204 AECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAA 263 AE R+ ++LGADAVGMSTV EVI ARH GLRV G S +TNK + D +++A EEV+ Sbjct: 205 AETRMYRQLGADAVGMSTVLEVIAARHMGLRVLGISCLTNKNLPD--CMQEAPLEEVIRV 262 Query: 264 GKQAAQKLEQFVSILMASI 282 +A KL + V+ ++ + Sbjct: 263 AGEAGDKLTRLVAAVVERV 281 Lambda K H 0.321 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 281 Length adjustment: 26 Effective length of query: 263 Effective length of database: 255 Effective search space: 67065 Effective search space used: 67065 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate 8500058 DvMF_0821 (purine nucleoside phosphorylase (RefSeq))
to HMM TIGR01700 (purine nucleoside phosphorylase I, inosine and guanosine-specific (EC 2.4.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01700.hmm # target sequence database: /tmp/gapView.19616.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01700 [M=249] Accession: TIGR01700 Description: PNPH: purine nucleoside phosphorylase I, inosine and guanosine-specific Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-96 308.4 0.0 2.1e-96 308.1 0.0 1.0 1 lcl|FitnessBrowser__Miya:8500058 DvMF_0821 purine nucleoside phos Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8500058 DvMF_0821 purine nucleoside phosphorylase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 308.1 0.0 2.1e-96 2.1e-96 2 248 .. 33 278 .. 32 279 .. 0.97 Alignments for each domain: == domain 1 score: 308.1 bits; conditional E-value: 2.1e-96 TIGR01700 2 iaiilGsGlGelaekvedavildyseiPefpestveGhkGklvfGklegkkvvilqGrfhlyegydlakvtfPvrvl 78 +++++G+GlG la+ + da l+ys +P fp+stv h+G+++fG+++ ++vv+ qGr hlyegy + v++ vrv+ lcl|FitnessBrowser__Miya:8500058 33 VGVVCGTGLGGLADALADARPLPYSRVPGFPQSTVASHEGRFLFGRIGTVEVVLQQGRCHLYEGYAPEDVCMGVRVM 109 89*************************************************************************** PP TIGR01700 79 kllGvealvvtnaaGgintefkvGdlmlikdhinllalnPliGpneekfGarfpdmsdaydkelrqkakeiakeldi 155 +lGve+lv+tnaaG++n+ + +Gdlmli+dhin+ +++Pl Gpn++ G+rfpdms yd l + a e a +l++ lcl|FitnessBrowser__Miya:8500058 110 AALGVEMLVITNAAGALNPRWDAGDLMLITDHINFTGRSPLTGPNHDAWGPRFPDMSAPYDATLGRIAMEEAARLGV 186 ***************************************************************************** PP TIGR01700 156 tlkeGvyvavtGPsyetpaevrllkklGadavGmstvpevivarhcGlrvlglslitnkaagildaelsdheevlev 232 +l++Gvyv+v GP+ etpae+r++++lGadavGmstv evi+arh Glrvlg+s++tnk +e+ eev++v lcl|FitnessBrowser__Miya:8500058 187 RLERGVYVGVPGPQMETPAETRMYRQLGADAVGMSTVLEVIAARHMGLRVLGISCLTNKNLPDCMQEAP-LEEVIRV 262 ***********************************************************9965555555.89***** PP TIGR01700 233 akkakekleklvsalv 248 a +a +kl++lv+a+v lcl|FitnessBrowser__Miya:8500058 263 AGEAGDKLTRLVAAVV 278 *************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (249 nodes) Target sequences: 1 (281 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.57 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory