Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate AO353_21815 AO353_21815 phospho-2-dehydro-3-deoxyheptonate aldolase
Query= BRENDA::P00888 (356 letters) >FitnessBrowser__pseudo3_N2E3:AO353_21815 Length = 359 Score = 366 bits (940), Expect = e-106 Identities = 183/336 (54%), Positives = 234/336 (69%), Gaps = 4/336 (1%) Query: 15 QVLMTPEQLKAAFPLSLQQEAQIADSRKSISDIIAGRDPRLLVVCGPCSIHDPETALEYA 74 Q L + QLK PLSL Q+A R+++ I+ G D RLLVV GPCSIHDP++ALEYA Sbjct: 22 QRLPSSLQLKHQLPLSLTLTQQVAAHREAVRAILDGEDSRLLVVVGPCSIHDPQSALEYA 81 Query: 75 RRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLQIARKLLLEL 134 + LA +VSD + +VMR Y EKPRTTVGWKGL DPH+DGS D+ GL ++R+L+ E+ Sbjct: 82 GKLARLATDVSDEMLVVMRAYIEKPRTTVGWKGLAYDPHLDGSDDMVGGLTLSRELMREM 141 Query: 135 VNMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGLSMPVGFKNGTDGSL 194 + +GLP+ATE L P + Y DL SW AIGARTTESQ HREMASGL MPVGFKNGTDG + Sbjct: 142 LRLGLPIATELLQPMAASYFDDLLSWVAIGARTTESQIHREMASGLGMPVGFKNGTDGGV 201 Query: 195 ATAINAMRAAAQPHRFVGINQAGQVALLQTQGNPDGHVILRGG-KAPNYSPADVAQCEKE 253 A +AMR+AA PHR G++ G A++QTQGNPD H++LRGG + PNY VAQ + + Sbjct: 202 GVATDAMRSAAHPHRHFGVDSQGHPAIIQTQGNPDTHLVLRGGHRGPNYDVQSVAQIQND 261 Query: 254 MEQAGLRPSLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGLMIESNIHEGNQSS 313 +++ + +MVDCSH NS KD RQPAV V+ Q GNRS+IG+M+ES++ EG Q Sbjct: 262 LQKLKIASRIMVDCSHANSGKDPLRQPAVFNEVLEQRLSGNRSLIGMMLESHLFEGCQPL 321 Query: 314 EQPRSEMKYGVSVTDACISWEMTDALLREIHQDLNG 349 + ++YGVSVTD C+ WE T+ LLR L G Sbjct: 322 S---TSLRYGVSVTDGCLGWEATEQLLRNASLKLRG 354 Lambda K H 0.316 0.131 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 421 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 359 Length adjustment: 29 Effective length of query: 327 Effective length of database: 330 Effective search space: 107910 Effective search space used: 107910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate AO353_21815 AO353_21815 (phospho-2-dehydro-3-deoxyheptonate aldolase)
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.17856.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-137 443.1 0.0 3.4e-137 442.8 0.0 1.0 1 lcl|FitnessBrowser__pseudo3_N2E3:AO353_21815 AO353_21815 phospho-2-dehydro-3- Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo3_N2E3:AO353_21815 AO353_21815 phospho-2-dehydro-3-deoxyheptonate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 442.8 0.0 3.4e-137 3.4e-137 9 335 .. 22 349 .. 16 355 .. 0.98 Alignments for each domain: == domain 1 score: 442.8 bits; conditional E-value: 3.4e-137 TIGR00034 9 delltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyakrlkk 73 ++l + +lk++ pl+ + +++va r+++ il+G+d+rllvv+GPcsihdp++aleya +l++ lcl|FitnessBrowser__pseudo3_N2E3:AO353_21815 22 QRLPSSLQLKHQLPLSLTLTQQVAAHREAVRAILDGEDSRLLVVVGPCSIHDPQSALEYAGKLAR 86 56778899********************************************************* PP TIGR00034 74 laeklkddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplate 138 la +++d++ +vmr+y+ekPrttvGWkGl dP+l++s d+ Gl ++r+l+ ++ lglp+ate lcl|FitnessBrowser__pseudo3_N2E3:AO353_21815 87 LATDVSDEMLVVMRAYIEKPRTTVGWKGLAYDPHLDGSDDMVGGLTLSRELMREMLRLGLPIATE 151 ***************************************************************** PP TIGR00034 139 lldtispqyladllswgaiGarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehl 203 ll+++++ y+ dllsw aiGarttesq+hre+asgl +pvgfkngtdG++ va da+r+aa++h+ lcl|FitnessBrowser__pseudo3_N2E3:AO353_21815 152 LLQPMAASYFDDLLSWVAIGARTTESQIHREMASGLGMPVGFKNGTDGGVGVATDAMRSAAHPHR 216 ***************************************************************** PP TIGR00034 204 flsvtkaGqvaivetkGnedghiilrGGkk.pnydaedvaevkeelekaglkeelmidfshgnsn 267 ++v+ +G+ ai++t+Gn+d+h++lrGG++ pnyd ++va+++++l+k++ +++m+d+sh+ns lcl|FitnessBrowser__pseudo3_N2E3:AO353_21815 217 HFGVDSQGHPAIIQTQGNPDTHLVLRGGHRgPNYDVQSVAQIQNDLQKLKIASRIMVDCSHANSG 281 ******************************9********************************** PP TIGR00034 268 kdykrqlevaesvveqiaeGekaiiGvmiesnleeGnqslkeelkyGksvtdacigwedteallr 332 kd rq++v ++v eq +G++++iG+m+es+l eG q l+ +l yG+svtd c+gwe te+llr lcl|FitnessBrowser__pseudo3_N2E3:AO353_21815 282 KDPLRQPAVFNEVLEQRLSGNRSLIGMMLESHLFEGCQPLSTSLRYGVSVTDGCLGWEATEQLLR 346 ****************************************************************9 PP TIGR00034 333 kla 335 + + lcl|FitnessBrowser__pseudo3_N2E3:AO353_21815 347 NAS 349 865 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (359 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.08 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory