Align ABC transporter for D-Glucosamine, permease component 1 (characterized)
to candidate AZOBR_RS27985 AZOBR_RS27985 ABC transporter permease
Query= reanno::Smeli:SM_b21219 (281 letters) >FitnessBrowser__azobra:AZOBR_RS27985 Length = 280 Score = 171 bits (434), Expect = 1e-47 Identities = 101/274 (36%), Positives = 158/274 (57%), Gaps = 19/274 (6%) Query: 12 IHASALLLAVVILAPVAWLLIMSISPAADLSAKPLAWWPSDIDLSRYRTLLSAVENSAG- 70 +HA+AL L +++L P AW++ M++ PA D L L +EN Sbjct: 20 LHAAALALLLLVLFPFAWMVQMALRPA-------------DAVLDDAVLFLPTLENFVAL 66 Query: 71 --AAFIASLLNSIKVAGMATLAAVVVAVPAAWAVSRTPAVAWSLYA--VIATYMLPPVAL 126 F S LNS+ V+ ++T A++ + VPAA+ ++R A A ++AT M PP+AL Sbjct: 67 WQGHFPKSFLNSVLVSSLSTAASLALGVPAAYVLTRWRFRARRRVALWILATRMAPPIAL 126 Query: 127 AVPLYMGLAYFGLLNSVFGLALVYLTILAPFTTWLLKSGFDSIPREIESAAMIDGARLDQ 186 +P ++ + GL +SV GLAL+Y+T W +++ F +IPR +E AA IDG + Q Sbjct: 127 TIPFFLAYRWVGLQDSVVGLALIYMTFNISIVVWFMQTFFAAIPRSLEEAAWIDGCGVWQ 186 Query: 187 ILRILTLPLAAPVMATSALFAFLLAWDEFFYALLFTSDQRAKTLTVAIADLAGGRVSDYG 246 R +TLPLAAP +A +A+F F+ +W++FF+AL+ T A T VAI + ++G Sbjct: 187 AFRRVTLPLAAPGLAATAVFCFIFSWNDFFFALILTR-TNAVTAPVAITNFLQYEGWEWG 245 Query: 247 LIATAGVLAALPPVLIGLIMQRALISGLTSGGVK 280 IA AG L LP + L++++ L+ GLT+GG+K Sbjct: 246 KIAAAGTLVMLPVLAFTLLVRKYLVRGLTAGGLK 279 Lambda K H 0.325 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 280 Length adjustment: 26 Effective length of query: 255 Effective length of database: 254 Effective search space: 64770 Effective search space used: 64770 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory