Align NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate AZOBR_RS29670 AZOBR_RS29670 ABC transporter permease
Query= TCDB::P74318 (286 letters) >FitnessBrowser__azobra:AZOBR_RS29670 Length = 290 Score = 162 bits (411), Expect = 6e-45 Identities = 92/280 (32%), Positives = 155/280 (55%), Gaps = 4/280 (1%) Query: 5 QLIFNGIAVGSIIALGAVGLTLTYGILRLSNFAHGDFMTLAAYLTWW-ANTSGINLWLSM 63 Q + N + +G AL +GLTL +GI+R+ NF HG+ T AY+ + A G+N ++S+ Sbjct: 6 QHLLNAVVLGGTYALLGIGLTLIFGIMRVVNFTHGELYTFGAYMAYMLAGMMGLNFFMSL 65 Query: 64 ALGCVGTIIAMFIGEWLLWKPMRARRATATTLIIISIGLALFLRNGILLIWGGNNQNYRV 123 A+ V + + E+ L +P++ T L++I G+A+ + G L+WGG ++ Sbjct: 66 AMAAVLGMALGALIEFTLLRPLKGADIDTTMLVMIGAGIAM--QAGEQLVWGGVAKSVPS 123 Query: 124 PIVPAQDFMG-IKFEYYRLLVIAMAIAAMVVLHLILQRTKVGKAMRAVADNVDLAKVSGI 182 P +G + RL V+ +A+ + +L++ RTK+G AMRA + D A + G+ Sbjct: 124 PFPTEPVVLGSVSVGMNRLFVLGVALLLLGGFYLLINRTKLGVAMRATFQDPDTAALMGV 183 Query: 183 NVEWVVMWTWVMTAVLTALGGSMYGLMTTLKPNMGWFLILPMFASVILGGIGNPYGAIAG 242 N + T+ + + L A G++ G + + P MG + L FA VILGG+GN GA G Sbjct: 184 NRGLMYTLTFALGSGLAATAGALLGPIFVVTPTMGDLVALKAFAIVILGGLGNIPGATIG 243 Query: 243 GIIIGVAQEVSVPWFGTSYKMGVALLLMIIILFIRPQGLF 282 G ++ +A+E + + Y+ + LL+I +L +RPQGLF Sbjct: 244 GFVLALAEEFGAGYLSSGYRDAMGFLLIIAVLIVRPQGLF 283 Lambda K H 0.329 0.143 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 290 Length adjustment: 26 Effective length of query: 260 Effective length of database: 264 Effective search space: 68640 Effective search space used: 68640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory