Align Arginase 1, mitochondrial; Agmatinase ARGAH1; Arginine amidohydrolase 1; EC 3.5.3.1; EC 3.5.3.11 (characterized)
to candidate AZOBR_RS30775 AZOBR_RS30775 agmatinase
Query= SwissProt::P46637 (342 letters) >FitnessBrowser__azobra:AZOBR_RS30775 Length = 351 Score = 110 bits (274), Expect = 7e-29 Identities = 89/283 (31%), Positives = 131/283 (46%), Gaps = 29/283 (10%) Query: 66 SLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSATEEGKELKDPRVLTDVGDVPVQE- 124 +L+GVP+ + G P +R G A L DVGDVP+ Sbjct: 71 ALIGVPMDLGVTNRAGARLGPRAVRGMERIGPYEHALRMVPAASCK--LADVGDVPLSSR 128 Query: 125 --IRDCGVDDDRLMNVISESVKLVMEEEPLRPLVLGGDHSISYPVVRAVSEKLGGPVDIL 182 + C D N + ++ + PL +GGDHSI+Y +++A+ + PV ++ Sbjct: 129 FSLEACHGDILAFYNRVMDAGVV--------PLSVGGDHSITYSILKALGRER--PVGMI 178 Query: 183 HLDAHPDIYDCFEGNKYSHASSFARIMEGGYA--RRLLQVGIRSINQEGREQGKRFGVEQ 240 H DAH D +EG K+ H F + + G R +Q+GIR + E F + Sbjct: 179 HFDAHCDTGGPYEGAKFHHGGPFRQAVLDGVLDPERTVQIGIRGSTEYLWE----FSYDS 234 Query: 241 YEMRTFSKDRP------MLENLKLGEGVKGVYISIDVDCLDPAFAPGVSHIEPGGLSFRD 294 ++D P ++E + G VY+S DVDCLDP FAPG E GGL+ R+ Sbjct: 235 GMTVIHAEDIPERGIASVIETARKVVGDGPVYVSFDVDCLDPVFAPGTGTPEVGGLTTRE 294 Query: 295 VLNILHNLQA-DVVGADVVEFNPQRDTVDGMTAMVAAKLVREL 336 L IL L D++G DVVE PQ D TA A+++ E+ Sbjct: 295 ALAILRGLDGLDIIGGDVVEVAPQYDATTN-TAHAGAQMLFEI 336 Lambda K H 0.318 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 342 Length of database: 351 Length adjustment: 29 Effective length of query: 313 Effective length of database: 322 Effective search space: 100786 Effective search space used: 100786 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory