Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate Ac3H11_771 Anthranilate phosphoribosyltransferase (EC 2.4.2.18)
Query= SwissProt::Q8PD71 (345 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_771 Length = 346 Score = 470 bits (1209), Expect = e-137 Identities = 235/338 (69%), Positives = 277/338 (81%) Query: 1 MPITPQQALQRTIEHREIFHDEMVDLMRQIMRGEVSDAMVSAILTGLRVKKETIGEIAGA 60 MPITPQ+ALQRTIEHREIFHDEM+ LMR IM+GE+S M +AI+TGLRVKKETIGEI A Sbjct: 1 MPITPQEALQRTIEHREIFHDEMLHLMRLIMKGELSPLMTAAIITGLRVKKETIGEITAA 60 Query: 61 ATVMREFSRRVEVTDRRHMVDIVGTGGDGSHTFNISTCAMFVAAAGGAKVAKHGNRSVSS 120 A VMREFS +V V D +H+VDIVGTGGDG++TFNISTC+MFVAAA GAKV+KHG R VSS Sbjct: 61 AQVMREFSTKVHVPDSKHLVDIVGTGGDGANTFNISTCSMFVAAAAGAKVSKHGGRGVSS 120 Query: 121 KSGSADALEALGAVIELQPEQVAASLAQTGIGFMYAPVHHPAMKVVAPVRREMGVRTIFN 180 KSGSAD +EALG I L+PE +A +A+ GIGFM+AP HHPAMK VAPVR+E+GVRTIFN Sbjct: 121 KSGSADVMEALGIHINLKPESIAQCIAEVGIGFMFAPNHHPAMKNVAPVRKELGVRTIFN 180 Query: 181 ILGPLTNPAGSPNILMGVFHPDLVGIQARVLQELGAERALVVWGRDGMDELSLGAGTLVG 240 ILGPLTNPA +PNILMGVFHPDLVGIQ R LQ LGAE A+VV+GRDGMDE+SLGA TLVG Sbjct: 181 ILGPLTNPASAPNILMGVFHPDLVGIQVRALQRLGAEHAMVVYGRDGMDEVSLGAATLVG 240 Query: 241 ELRDGQVHEYEVHPEDFGIAMSASRNLKVADAAESRAMLLQVLDNVPGPALDIVALNAGA 300 EL++GQ+ EYE+HPEDFG++M+++R LKV +SR ML+ VL PG A DIV LNAG Sbjct: 241 ELKNGQITEYEIHPEDFGLSMASNRALKVETPEQSREMLIGVLKGEPGAAQDIVCLNAGV 300 Query: 301 ALYVAGVADSIADGIVRARQVLADGSARACLDAYVAFT 338 ALY A V DS+ G+ +AR +A G+A A L+ V T Sbjct: 301 ALYAANVVDSVPAGLAKARAAIASGAALAKLEQMVTRT 338 Lambda K H 0.320 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 429 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 346 Length adjustment: 29 Effective length of query: 316 Effective length of database: 317 Effective search space: 100172 Effective search space used: 100172 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate Ac3H11_771 (Anthranilate phosphoribosyltransferase (EC 2.4.2.18))
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.17270.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-129 417.5 2.6 2.4e-129 417.3 2.6 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_771 Anthranilate phosphoribosyltrans Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_771 Anthranilate phosphoribosyltransferase (EC 2.4.2.18) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 417.3 2.6 2.4e-129 2.4e-129 1 328 [. 9 335 .. 9 337 .. 0.99 Alignments for each domain: == domain 1 score: 417.3 bits; conditional E-value: 2.4e-129 TIGR01245 1 leklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkv 63 l++ ++++++ ++e+ +lm+ im+ge+s+ aAi++ lrvk et+ ei+++a+++re ++kv lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_771 9 LQRTIEHREIFHDEMLHLMRLIMKGELSPLMTAAIITGLRVKKETIGEITAAAQVMREFSTKV 71 578999********************************************************* PP TIGR01245 64 ekeeseelvDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvn 126 ++ +s++lvDivGTGGDg++t+NiST s++vaaaaG+kv KhG r vssksGsaDv+ealg++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_771 72 HVPDSKHLVDIVGTGGDGANTFNISTCSMFVAAAAGAKVSKHGGRGVSSKSGSADVMEALGIH 134 **9************************************************************ PP TIGR01245 127 lelspekvarsleevgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlG 189 ++l+pe++a++++evgigF+fAP++hpa+k+vapvRkeLgvrt+fN+LGPL+nPa+a++ ++G lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_771 135 INLKPESIAQCIAEVGIGFMFAPNHHPAMKNVAPVRKELGVRTIFNILGPLTNPASAPNILMG 197 *************************************************************** PP TIGR01245 190 vyskdlvevlaevlknlgvkralvvhgedglDEisltgetkvaelkdgeieeytlspedfglk 252 v+++dlv + +++l++lg+++a+vv g+dg+DE+sl + t v elk+g+i+ey+++pedfgl lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_771 198 VFHPDLVGIQVRALQRLGAEHAMVVYGRDGMDEVSLGAATLVGELKNGQITEYEIHPEDFGLS 260 *************************************************************** PP TIGR01245 253 raeleelkggsaeenaellkevlegkekkakrdivvlNaaaalyvagkakdlkegvelakeai 315 +a+ ++lk++++e++ e+l vl+g+ +a++div lNa++aly+a++++++ +g+ a++ai lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_771 261 MASNRALKVETPEQSREMLIGVLKGEP-GAAQDIVCLNAGVALYAANVVDSVPAGLAKARAAI 322 *************************99.899******************************** PP TIGR01245 316 ksgkalekleelv 328 sg+al+kle++v lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_771 323 ASGAALAKLEQMV 335 **********997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (346 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 12.02 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory