Align diaminopimelate decarboxylase (EC 4.1.1.20) (characterized)
to candidate BPHYT_RS17930 BPHYT_RS17930 diaminopimelate decarboxylase
Query= BRENDA::Q9KVL7 (417 letters) >FitnessBrowser__BFirm:BPHYT_RS17930 Length = 420 Score = 482 bits (1240), Expect = e-140 Identities = 240/410 (58%), Positives = 304/410 (74%), Gaps = 2/410 (0%) Query: 9 DGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDYPHLICYAVKANSNLGV 68 DG L AE V LA Q+GTPLYVYSRA L W+A+ + + AVKANSNL V Sbjct: 10 DGVLHAEGVSAVSLAEQFGTPLYVYSRAALTEAWNAYAGACAGRRASVHVAVKANSNLAV 69 Query: 69 LNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKIKCFNVESE 128 LN ARLG+GFDIVS GEL RVLAAGG VFSGVGK EM+ AL +KCFNVES Sbjct: 70 LNVFARLGAGFDIVSGGELARVLAAGGRAENTVFSGVGKHADEMRDALAAGVKCFNVESI 129 Query: 129 PELQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAAQVYRLAHS 188 PEL RLN VA +G KAP+SLR+NPDVDAKTHPYISTGL+ NKFG+ F+ A Y+ A + Sbjct: 130 PELDRLNAVAAAMGKKAPVSLRVNPDVDAKTHPYISTGLKSNKFGVAFEDARATYQAAAA 189 Query: 189 LPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGGLGVVYRDE 248 + NL+V GIDCHIGSQ+T +AP++DA D++L L++ ++ +G+ IRH+DVGGGLG+ Y DE Sbjct: 190 MANLEVVGIDCHIGSQITEVAPYLDAVDKVLELVEQIEQDGVKIRHIDVGGGLGITYDDE 249 Query: 249 LPPQPSEYAKALLDRLER--HRDLELIFEPGRAIAANAGVLVTKVEFLKHTEHKNFAIID 306 PP+ E+ + +LDR+E H E+ FEPGR++ NAG+L+T+VEFLK KNFAI+D Sbjct: 250 TPPEIGEFVRTVLDRIEARGHGHREVYFEPGRSLVGNAGMLLTRVEFLKPGAEKNFAIVD 309 Query: 307 AAMNDLIRPALYQAWQDIIPLRPRQGEAQTYDLVGPVCETSDFLGKDRDLVLQEGDLLAV 366 AAM DL RPA+Y+A+ I P+ R A YD+VGPVCE+ D+LG++R L ++ GDLLA+ Sbjct: 310 AAMTDLARPAMYEAYHAIDPVVKRDVPAHVYDVVGPVCESGDWLGRERLLSVEPGDLLAI 369 Query: 367 RSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALESVLP 416 RS+GAYGF MSSNYNTRPR AEVMVDG + ++VR REE+ L+A E++LP Sbjct: 370 RSAGAYGFVMSSNYNTRPRAAEVMVDGTQVHVVRAREEVKQLFAGETILP 419 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 470 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 420 Length adjustment: 32 Effective length of query: 385 Effective length of database: 388 Effective search space: 149380 Effective search space used: 149380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate BPHYT_RS17930 BPHYT_RS17930 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.20328.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-160 520.4 0.0 1.5e-160 520.2 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS17930 BPHYT_RS17930 diaminopimelate de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS17930 BPHYT_RS17930 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 520.2 0.0 1.5e-160 1.5e-160 6 416 .. 10 415 .. 6 416 .. 0.98 Alignments for each domain: == domain 1 score: 520.2 bits; conditional E-value: 1.5e-160 TIGR01048 6 dgeleiegvdlkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllaeeGlg 75 dg l +egv++ +lae+fgtPlYvy++++l+e+++a++ a +++++ v+ AvKAnsnlavl+++a++G+g lcl|FitnessBrowser__BFirm:BPHYT_RS17930 10 DGVLHAEGVSAVSLAEQFGTPLYVYSRAALTEAWNAYAGACAGRRASVHVAVKANSNLAVLNVFARLGAG 79 78999**************************************999************************ PP TIGR01048 76 ldvvsgGEleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgkkarvl 145 +d+vsgGEl+r+laAg +ae+ vfsg+gk +e+++al++++k++nv+s+ el++l+++a+ +gkka+v+ lcl|FitnessBrowser__BFirm:BPHYT_RS17930 80 FDIVSGGELARVLAAGGRAENTVFSGVGKHADEMRDALAAGVKCFNVESIPELDRLNAVAAAMGKKAPVS 149 ********************************************************************** PP TIGR01048 146 lRvnpdvdaktheyisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfveaaekv 215 lRvnpdvdakth+yisTGlk++KFG+++e+a+++y++a+++++le+vGi++HIGSqi++++p+ +a++kv lcl|FitnessBrowser__BFirm:BPHYT_RS17930 150 LRVNPDVDAKTHPYISTGLKSNKFGVAFEDARATYQAAAAMANLEVVGIDCHIGSQITEVAPYLDAVDKV 219 ********************************************************************** PP TIGR01048 216 vklleelkeegieleeldlGGGlgisyeeeeeapdleeyaeklleklekeaelgl.klklilEpGRslva 284 ++l+e+++++g++++++d+GGGlgi+y++e+ +p++ e+++++l+++e + g+ + ++ +EpGRslv+ lcl|FitnessBrowser__BFirm:BPHYT_RS17930 220 LELVEQIEQDGVKIRHIDVGGGLGITYDDET-PPEIGEFVRTVLDRIEAR---GHgHREVYFEPGRSLVG 285 *****************************99.************999994...66699************ PP TIGR01048 285 nagvlltrVesvKevesrkfvlvDagmndliRpalYeayheiaalkrleeeetetvdvvGplCEsgDvla 354 nag+lltrVe++K +++f++vDa+m+dl Rpa+Yeayh i ++ ++ +++++dvvGp+CEsgD l+ lcl|FitnessBrowser__BFirm:BPHYT_RS17930 286 NAGMLLTRVEFLKPGAEKNFAIVDAAMTDLARPAMYEAYHAIDPV-VKRDVPAHVYDVVGPVCESGDWLG 354 *********************************************.56999******************* PP TIGR01048 355 kdrelpeveeGdllavasaGAYgasmssnYnsrprpaevlveegkarlirrretledllale 416 ++r l +ve+Gdlla++saGAYg+ mssnYn+rpr+aev+v++ +++++r re++++l+a e lcl|FitnessBrowser__BFirm:BPHYT_RS17930 355 RERLL-SVEPGDLLAIRSAGAYGFVMSSNYNTRPRAAEVMVDGTQVHVVRAREEVKQLFAGE 415 *9966.6999************************************************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (420 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.70 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory