Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate CCNA_02230 CCNA_02230 gluconate 2-dehydrogenase
Query= BRENDA::O58256 (333 letters) >FitnessBrowser__Caulo:CCNA_02230 Length = 319 Score = 131 bits (329), Expect = 3e-35 Identities = 88/262 (33%), Positives = 139/262 (53%), Gaps = 16/262 (6%) Query: 54 ITREVLENAERLKVISCHSAGYDNIDLEEATKRGIYVTKVSGLLSEAVAEFTVGLIINLM 113 ++R++L RL +I+C S GYD +D+ GI VT +GL + VA+ VGL++ Sbjct: 62 LSRDMLAEMPRLGLIACVSVGYDGVDVPWCKAHGIAVTHSTGLNAADVADHAVGLVLAAW 121 Query: 114 RKIHYADKFIRRGEWESHAKIWTGFKRIESLYGKKVGILGMGAIGKAIARRLIPFGVKLY 173 R I D+ +R G W SHA+ L G+K G++G+G IG+A+A RL F +K+ Sbjct: 122 RGIVEGDQRLRGGHW-SHAE---RMAPRPGLRGRKAGVVGLGHIGEAVAARLKAFDMKVA 177 Query: 174 YWSRHRKVNVEKELKARYMDIDELL---EKSDIVILALPLTRDTYHIINEERVKKLEGK- 229 +W+ K + Y D L+ SD++I+ H+IN+ ++ + + Sbjct: 178 WWAPRPK-------ETDYPRADSLMALARDSDVLIVCARPDDSNRHLINKPVIEAVGAQG 230 Query: 230 YLVNIGRGALVDEKAVTEAIKQGKLKGYATDVFEKEPVREHELFKYEWETVLTPHYAGLA 289 +VN+ RG+L+DE A+ +A++ G L A DVFE+EP TVLTPH AG Sbjct: 231 LIVNVARGSLIDEDALIQALRAGTLGMAALDVFEQEPTPAARWADVP-RTVLTPHTAGAT 289 Query: 290 LEAQEDVGFRAVENLLKVLRGE 311 L++ + +ENL + GE Sbjct: 290 LDSLPAMVSLTLENLRRYFHGE 311 Lambda K H 0.319 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 319 Length adjustment: 28 Effective length of query: 305 Effective length of database: 291 Effective search space: 88755 Effective search space used: 88755 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory