Align Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 (characterized)
to candidate Dsui_1036 Dsui_1036 ribose-phosphate pyrophosphokinase
Query= SwissProt::P0A1V6 (315 letters) >FitnessBrowser__PS:Dsui_1036 Length = 317 Score = 403 bits (1036), Expect = e-117 Identities = 203/311 (65%), Positives = 257/311 (82%), Gaps = 2/311 (0%) Query: 4 MKLFAGNATPELAQRIANRL-YTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTCAP 62 + +F GNA P+LA + +RL LG A+VGRFSDGEVSV+I E+VRG D+FI+QSTCAP Sbjct: 6 LMVFTGNANPKLAADVVSRLGRRPLGRASVGRFSDGEVSVEIEEHVRGHDVFILQSTCAP 65 Query: 63 TNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSVGV 122 +ND LMEL+VMVDAL+RASAGRITA IPYFGYARQDRR RS+RVPI AK+VAD L++ GV Sbjct: 66 SNDTLMELLVMVDALKRASAGRITAAIPYFGYARQDRRSRSSRVPIAAKLVADLLTAAGV 125 Query: 123 DRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQLNLDNPIVVSPDIGGVVRARAIAK 182 DRVLT+DLHAEQIQGFFD+PVDNV+ PILLED+ + N +N +VVSPD GGVVRAR++AK Sbjct: 126 DRVLTMDLHAEQIQGFFDIPVDNVYALPILLEDIQKQNHENLLVVSPDHGGVVRARSLAK 185 Query: 183 LLNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAK 242 L + D+AIIDKRRP+ANVS+VM+IIG+V GR C+++DD++DT GTLCKAA ALK GA+ Sbjct: 186 RL-ECDLAIIDKRRPKANVSEVMNIIGEVDGRTCIIMDDIVDTAGTLCKAASALKANGAQ 244 Query: 243 RVFAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLTDEIKALPNVRTLTLSGMLAEAIRR 302 +V AY THP+ SG A + +S +DE+VV DTIPL D+ A +R L+++ +LAE IRR Sbjct: 245 KVVAYCTHPVLSGAAVERVNSSDLDELVVTDTIPLRDDAMACSRIRQLSVAELLAETIRR 304 Query: 303 ISNEESISAMF 313 ISNE+S+S++F Sbjct: 305 ISNEDSVSSLF 315 Lambda K H 0.322 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 317 Length adjustment: 27 Effective length of query: 288 Effective length of database: 290 Effective search space: 83520 Effective search space used: 83520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate Dsui_1036 Dsui_1036 (ribose-phosphate pyrophosphokinase)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.28510.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-126 407.6 0.4 1.5e-126 407.4 0.4 1.0 1 lcl|FitnessBrowser__PS:Dsui_1036 Dsui_1036 ribose-phosphate pyrop Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_1036 Dsui_1036 ribose-phosphate pyrophosphokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 407.4 0.4 1.5e-126 1.5e-126 2 308 .. 7 315 .. 6 316 .. 0.98 Alignments for each domain: == domain 1 score: 407.4 bits; conditional E-value: 1.5e-126 TIGR01251 2 kilsgssskelaekvaknlg.lelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvndalmellllidalkr 77 +++ g+++++la+ v +lg +lg+++v +F+dgE++v+iee+vrg+dvfi+ qst+ap nd lmell+++dalkr lcl|FitnessBrowser__PS:Dsui_1036 7 MVFTGNANPKLAADVVSRLGrRPLGRASVGRFSDGEVSVEIEEHVRGHDVFIL-QSTCAPSNDTLMELLVMVDALKR 82 89***********99999972579*****************************.*********************** PP TIGR01251 78 asaksvtaviPyygYaRqdkkak.srepisaklvaklleeaGadrvltvdlHseqiqgfFdvpvenlsaspklieel 153 asa+++ta iPy+gYaRqd++ + sr pi+aklva+ll++aG+drvlt+dlH+eqiqgfFd+pv+n++a p l+e++ lcl|FitnessBrowser__PS:Dsui_1036 83 ASAGRITAAIPYFGYARQDRRSRsSRVPIAAKLVADLLTAAGVDRVLTMDLHAEQIQGFFDIPVDNVYALPILLEDI 159 ********************98768**************************************************** PP TIGR01251 154 kkkelknlvvvsPDkGaverakkvakklglelaiieKeRdskenevevtnllgdvegkdvvivDDiisTggTlvkaa 230 +k++ +nl+vvsPD+G+v ra+++ak+l+++laii+K+R+ k+n+ ev+n++g+v+g++++i+DDi++T+gTl+kaa lcl|FitnessBrowser__PS:Dsui_1036 160 QKQNHENLLVVSPDHGGVVRARSLAKRLECDLAIIDKRRP-KANVSEVMNIIGEVDGRTCIIMDDIVDTAGTLCKAA 235 ****************************************.899********************************* PP TIGR01251 231 elLkekGAkkvivaathgvfsgdAlerlaeagveevivtntilv.ee.kklpkvseisvapliaeaiarihenesvs 305 ++Lk +GA+kv++++th+v+sg A+er++++ ++e++vt+ti+ ++ ++++++++sva+l+ae+i+ri+++ svs lcl|FitnessBrowser__PS:Dsui_1036 236 SALKANGAQKVVAYCTHPVLSGAAVERVNSSDLDELVVTDTIPLrDDaMACSRIRQLSVAELLAETIRRISNEDSVS 312 ********************************************877899*************************** PP TIGR01251 306 slf 308 slf lcl|FitnessBrowser__PS:Dsui_1036 313 SLF 315 **9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (317 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.98 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory