Align N-succinyldiaminopimelate-aminotransferase (EC 2.6.1.17) (characterized)
to candidate Dsui_2708 Dsui_2708 succinyldiaminopimelate transaminase
Query= metacyc::MONOMER-6501 (397 letters) >FitnessBrowser__PS:Dsui_2708 Length = 401 Score = 465 bits (1197), Expect = e-136 Identities = 240/397 (60%), Positives = 286/397 (72%), Gaps = 5/397 (1%) Query: 1 MNPRLDALHPYPFEKLRALLADAGKPTHDLPPINLSIGEPKHAAPACVGQAIAANLAGLS 60 MNP L L PYPFEKLR L P D I LSIGEP+HA P + +A+ ANL GL+ Sbjct: 1 MNPFLAKLQPYPFEKLRQLFQGV-TPNPDYQEIKLSIGEPQHATPGFIKEALTANLGGLA 59 Query: 61 VYPSTKGEPALRQAISQWLSRRYSIPAPDPESEVLPVLGSREALFAFAQTVIDPSAG--A 118 YP+++G PALRQAI+ W+ RRY + +P++E+LPV GSREALFAFAQTVIDPS G Sbjct: 60 NYPTSQGTPALRQAIAAWMERRYGLAGVNPDTEILPVNGSREALFAFAQTVIDPSRGYVP 119 Query: 119 LVVCPNPFYQIYEGAALLAGATPYYVNADPARDFGLRTGRVPDEVWRRTQLVFVCSPGNP 178 LVV PNPFYQIYEGAA LAGA PY++N P DF L + + W R QL++VCSPGNP Sbjct: 120 LVVSPNPFYQIYEGAAYLAGAEPYFLNTLPENDFSLELEALSEADWARVQLLYVCSPGNP 179 Query: 179 AGNVMSLEEWRTLFELSDRHGFVIAAYECYSEIYLDEDTPPLGSLQAARRLGRDRYTNLV 238 G V+ LE+W+ LF LSD++GFVIA+ ECYSEIY DE PPLG LQAA++LGR + LV Sbjct: 180 TGKVLDLEDWKKLFALSDKYGFVIASDECYSEIYFDEAKPPLGGLQAAKQLGRG-FERLV 238 Query: 239 AFSSLSKRSNVPGMRSGFVAGDAALLARFLLYRTYHGSAMSPVVSAASIAAWSMRRMCRK 298 FSSLSKRSNVPG+RSGFVAGDAA+L +FLLYRTYHG AM+P V AAS AW+ R+ Sbjct: 239 MFSSLSKRSNVPGLRSGFVAGDAAVLKKFLLYRTYHGGAMNPAVQAASAIAWNEEAHARE 298 Query: 299 T-AQYRAKFEAVLPILQNVLDVRAPQASFYLWAGTPGSDTAFARELYGRTGVTVLPGSLL 357 QY+ KF+AV PI+ +VL P ASFYLWA TP +DT FAR L V VLPGS L Sbjct: 299 NRRQYKEKFDAVTPIVASVLQTGLPDASFYLWARTPIADTEFARRLLADYNVVVLPGSYL 358 Query: 358 AREAHNANPGQGRIRIALVAPLDQCVQAAERIAHFAR 394 AREA NPG+ +RIALVAPL C++AAERI F + Sbjct: 359 AREARGVNPGENFVRIALVAPLADCLEAAERIRLFVQ 395 Lambda K H 0.321 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 578 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 401 Length adjustment: 31 Effective length of query: 366 Effective length of database: 370 Effective search space: 135420 Effective search space used: 135420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate Dsui_2708 Dsui_2708 (succinyldiaminopimelate transaminase)
to HMM TIGR03538 (dapC: succinyldiaminopimelate transaminase (EC 2.6.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03538.hmm # target sequence database: /tmp/gapView.3014.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03538 [M=395] Accession: TIGR03538 Description: DapC_gpp: succinyldiaminopimelate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-190 619.0 0.0 1.8e-190 618.8 0.0 1.0 1 lcl|FitnessBrowser__PS:Dsui_2708 Dsui_2708 succinyldiaminopimelat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_2708 Dsui_2708 succinyldiaminopimelate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 618.8 0.0 1.8e-190 1.8e-190 1 395 [] 1 394 [. 1 394 [. 0.99 Alignments for each domain: == domain 1 score: 618.8 bits; conditional E-value: 1.8e-190 TIGR03538 1 mnpnlerlkpyPfeklaellkdvtppadleeialsiGePkhatPafvlealvenleelskyPttkGlpelreaiaeW 77 mnp l++l+pyPfekl++l+++vtp+ d++ei+lsiGeP+hatP f++eal++nl +l++yPt++G+p+lr+aia+W lcl|FitnessBrowser__PS:Dsui_2708 1 MNPFLAKLQPYPFEKLRQLFQGVTPNPDYQEIKLSIGEPQHATPGFIKEALTANLGGLANYPTSQGTPALRQAIAAW 77 9**************************************************************************** PP TIGR03538 78 lerrfelpagvdperqvlPvnGtrealfafvqavidrae..kalvvlPnPfyqiyeGaallagaepyflnctaengf 152 +err+ l+ v+p++++lPvnG+realfaf+q+vid+++ +lvv+PnPfyqiyeGaa+lagaepyfln+ +en+f lcl|FitnessBrowser__PS:Dsui_2708 78 MERRYGLAG-VNPDTEILPVNGSREALFAFAQTVIDPSRgyVPLVVSPNPFYQIYEGAAYLAGAEPYFLNTLPENDF 153 ******986.***************************99889*********************************** PP TIGR03538 153 kpdfdavpeevWkrvqllfvcsPgnPtGavlsleelkklleladkydfiiasdecyselyldeaeaPvGlleaaael 229 +++a++e W+rvqll+vcsPgnPtG+vl+le++kkl++l+dky+f+iasdecyse+y+dea++P+G l+aa++l lcl|FitnessBrowser__PS:Dsui_2708 154 SLELEALSEADWARVQLLYVCSPGNPTGKVLDLEDWKKLFALSDKYGFVIASDECYSEIYFDEAKPPLGGLQAAKQL 230 ***************************************************************************** PP TIGR03538 230 GrddfkrllvfhslskrsnvPGlrsGfvaGdaellkeflryrtyhGcampiavqlasiaaWedekhvrenralyrek 306 Gr f+rl++f+slskrsnvPGlrsGfvaGda++lk+fl yrtyhG am++avq+as aW++e+h renr++y+ek lcl|FitnessBrowser__PS:Dsui_2708 231 GR-GFERLVMFSSLSKRSNVPGLRSGFVAGDAAVLKKFLLYRTYHGGAMNPAVQAASAIAWNEEAHARENRRQYKEK 306 *8.9************************************************************************* PP TIGR03538 307 faavleilgavldlelPdasfylWlkvpdgddeafaralyeeenvkvlpGrylsreaegvnPGegrvrlalvaelee 383 f+av+ i+++vl+ lPdasfylW+++ ++ d++far+l ++ nv vlpG+yl+rea gvnPGe++vr+alva+l++ lcl|FitnessBrowser__PS:Dsui_2708 307 FDAVTPIVASVLQTGLPDASFYLWART-PIADTEFARRLLADYNVVVLPGSYLAREARGVNPGENFVRIALVAPLAD 382 ***************************.5************************************************ PP TIGR03538 384 cveaaerikkll 395 c eaaeri+ ++ lcl|FitnessBrowser__PS:Dsui_2708 383 CLEAAERIRLFV 394 ********9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (395 nodes) Target sequences: 1 (401 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.51 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory