Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate Echvi_0181 Echvi_0181 Phosphoglycerate dehydrogenase and related dehydrogenases
Query= BRENDA::F8A9V0 (325 letters) >FitnessBrowser__Cola:Echvi_0181 Length = 311 Score = 145 bits (366), Expect = 1e-39 Identities = 92/260 (35%), Positives = 132/260 (50%), Gaps = 10/260 (3%) Query: 56 DGPVLEALHSYGVGLLALRSAGYDHIDIETAKRLGIKVVNVPAYSPHAIADHTLAIMLAL 115 D P+LE + + AG D ID++ ++ GIK+ + P + A+ +H +A++L L Sbjct: 54 DKPLLEKAKK--LKFIGRAGAGLDKIDLDFIQKQGIKLFHAPEGNRDAVGEHAVAMLLML 111 Query: 116 IRRLHRAHDKVRLGDFDLDGLMGFDLNGKVAGVIGLGKIGRLVATRLKAFGCKVLGYDPY 175 L +A +VR G +D +G G +L GK G+ G G +G+ A RL FG KV+ YD Y Sbjct: 112 FNNLKKADSEVRQGVWDREGNRGEELQGKTVGIFGYGNMGKAFARRLSGFGVKVVAYDKY 171 Query: 176 I---QPEIVENVDLDTLITQADIISIHCPLTRENFHMFNEETFKRMKPGAILVNTARGGL 232 + E V D L QAD++SIH PLT E + F EE L+NTARG + Sbjct: 172 LDKYSDEYAAQVTFDQLQQQADVLSIHVPLTEETRNFFTEEVLAGFSKPFYLINTARGEV 231 Query: 233 IDTKALLEALKSGKLGGAALDVYEYERGLFFKNHQKEGIKDPYLAQLLGLANVVLTGHQA 292 I + L AL+ G L GA LDV E E K H ++ +L +V+ + H A Sbjct: 232 ISMETLNAALEKGILKGALLDVLENE-----KLHTLNDVQKTAFEKLSVRDDVLFSPHIA 286 Query: 293 FLTREAVKNIEETTVENILE 312 T ++ K I E V I E Sbjct: 287 GWTFQSYKKINEVLVSKISE 306 Lambda K H 0.321 0.140 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 311 Length adjustment: 27 Effective length of query: 298 Effective length of database: 284 Effective search space: 84632 Effective search space used: 84632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory