Align gluconokinase monomer (EC 2.7.1.12) (characterized)
to candidate Echvi_0478 Echvi_0478 6-phosphogluconate dehydrogenase, decarboxylating
Query= metacyc::HS14230-MONOMER (187 letters) >FitnessBrowser__Cola:Echvi_0478 Length = 636 Score = 136 bits (342), Expect = 9e-37 Identities = 77/179 (43%), Positives = 107/179 (59%), Gaps = 22/179 (12%) Query: 7 LLVMGVSGSGKSTVGALLASELGWKFYDADDYHPEENRRKMGKGIPLNDQDRIPWLCNLH 66 +L+MGVSGSGK+T+G +L+ ++G FYDADD+HP+ N KM GIPLNDQDR+PWL L Sbjct: 3 ILLMGVSGSGKTTIGRMLSGKVGLPFYDADDFHPKNNVEKMKAGIPLNDQDRVPWLETLS 62 Query: 67 DILLRDVASGQRVVLACSALKKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSG 126 + ++ +G +LACSALK +YR +L + +Q+ L G Sbjct: 63 EKMVAWEENG-GAILACSALKASYRKML------------------RSHAVQMRWFFLKG 103 Query: 127 SFEVISGRLLKREGHFMPPELLQSQFETLEPPAAPENFIQISVDKNVSEIIATIMETLK 185 +I+ R+ REGH+MP LL SQ ETLEP P++ IS+D+ I+ IM LK Sbjct: 104 DEALIAKRMKAREGHYMPASLLSSQLETLEP---PKHATIISIDQTPENILEDIMSDLK 159 Lambda K H 0.317 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 187 Length of database: 636 Length adjustment: 28 Effective length of query: 159 Effective length of database: 608 Effective search space: 96672 Effective search space used: 96672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory