Align Lactaldehyde reductase; Propanediol oxidoreductase; EC 1.1.1.77 (characterized)
to candidate Echvi_0924 Echvi_0924 Alcohol dehydrogenase, class IV
Query= SwissProt::P0A9S1 (382 letters) >FitnessBrowser__Cola:Echvi_0924 Length = 381 Score = 184 bits (466), Expect = 5e-51 Identities = 119/371 (32%), Positives = 187/371 (50%), Gaps = 12/371 (3%) Query: 13 FGRGAVGALTDEVKRRGYQKALIVTDKTLVQCGVVAKVTDKMDAAGLAW--AIYDGVVPN 70 FG G ++ +++ I+ + L+ + +M +AGL A+YD Sbjct: 14 FGVGGFSRFVEDTVAASHKRIWILVAQPLLD--TLDGGLQEMKSAGLEVEVAVYDA--GE 69 Query: 71 PTITVVKEGLGVFQNSGADYLIAIGGGSPQDTCKAIGIISNNPEFADVRSLEGLSPTNKP 130 PT + ++ L ++ GAD ++ IGGGS D K + + ++ + G++ Sbjct: 70 PTFSHYEDFLKQVKDFGADTIVGIGGGSVLDLAKLLAAMQDST--GQLSDFVGINLLESR 127 Query: 131 SVPILAIPTTAGTAAEVTINYVITDEEKRRKFVCVDPHDIPQVAFIDADMMDGMPPALKA 190 + ++ IPTTAGT +EV+ N ++ DE K + P +P +ID + G+PP + A Sbjct: 128 NTHMVCIPTTAGTGSEVSPNAILLDEATLEKKGIISPFLVPDATYIDPALTVGLPPKITA 187 Query: 191 ATGVDALTHAIEGYITRGAWALTDALHIKAIEIIAGALRGS--VAGDKDAGEEMALGQYV 248 TG+DAL+H IE Y + + L D ++ I +I L + V D DA +ALG Sbjct: 188 ETGIDALSHCIEAYTNKFSHPLVDDYALRGIALIGQNLHRAFEVPEDMDARTAVALGSMY 247 Query: 249 AGMGFSNVGLGLVHGMAHPLGAFYNTPHGVANAILLPHVMRYNADFTGEKYRDIARVMGV 308 G+ V VH +++PLG Y+ PHG+ANA+LLP VM YN +K+ IA MG Sbjct: 248 GGLCLGPVNTAAVHALSYPLGGKYHVPHGLANAVLLPEVMAYNLSSNIQKHEQIALAMGA 307 Query: 309 KVEGMSLEEARNAAVEAVFALNRDVGIPPHLRDVGVRKEDIPALAQAALDDV-CTGGNPR 367 + +G S EE + V+ V L + IP L +GV++ED+P L A+ NPR Sbjct: 308 E-QGNSPEETASNGVQKVKELVKRCDIPQDLTTLGVQQEDVPELTALAMKVTRLLKNNPR 366 Query: 368 EATLEDIVELY 378 E T D E+Y Sbjct: 367 EVTFADAEEIY 377 Lambda K H 0.319 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 390 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 381 Length adjustment: 30 Effective length of query: 352 Effective length of database: 351 Effective search space: 123552 Effective search space used: 123552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory