Align uridine phosphorylase (EC 2.4.2.2) (characterized)
to candidate Echvi_1798 Echvi_1798 Uridine phosphorylase
Query= metacyc::MONOMER-19659 (277 letters) >FitnessBrowser__Cola:Echvi_1798 Length = 287 Score = 101 bits (251), Expect = 2e-26 Identities = 86/260 (33%), Positives = 125/260 (48%), Gaps = 43/260 (16%) Query: 15 EGMQYHIACKPGDVARYVLLPGDPERVPKISSLWDEAREIAFHREYRTHTGKYKGVPISV 74 +G YH+ KP +A V+ GDPERVPKIS +D RE+ THTG YKG +SV Sbjct: 15 DGSIYHLNLKPEFLASNVITVGDPERVPKISQYFDHVDIKVAKREFVTHTGTYKGKRLSV 74 Query: 75 TSTGIGGPSTAIAIEELAAI--------------GADTFIRVGSTGAIQPGIEIGDLIIA 120 STG+G + I + EL A+ A +RVG++G+++ I G L+ + Sbjct: 75 MSTGMGTDNIEIFMTELDALVNIDLQTRQVKPKHTALNIVRVGTSGSMREEIPAGALVAS 134 Query: 121 KAAVRLEGTSKQYVRVEYPAVADLEVTLALIEAA-ESLGVRY------------------ 161 + AV L+ T QY +Y +D E A+ EA +SLGV + Sbjct: 135 EYAVGLD-TLMQYYAADY---SDKE--QAIREAVQQSLGVDFLPYCFEGSKKLLGQMNTK 188 Query: 162 --HIGITASTDSFYLGQGRP-GLNGYFPSFARNL-VDDLRQARVTNFEMEAATLYTLANI 217 +G TA+ F+ QGR L P L ++ ++TNFEME A Y + + Sbjct: 189 DMILGNTATCPGFFGPQGREVRLKPAIPDIIERLSAMEVDGFQLTNFEMETAGYYAMGKM 248 Query: 218 YGLRAGCVCAVFANRVTNEF 237 G + A+ ANR+T+ F Sbjct: 249 LGHEVLSLNAIVANRITHTF 268 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 277 Length of database: 287 Length adjustment: 26 Effective length of query: 251 Effective length of database: 261 Effective search space: 65511 Effective search space used: 65511 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory