Align Sorbitol dehydrogenase (EC 1.1.1.14) (characterized)
to candidate Echvi_2940 Echvi_2940 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= reanno::WCS417:GFF2259 (257 letters) >FitnessBrowser__Cola:Echvi_2940 Length = 251 Score = 140 bits (352), Expect = 3e-38 Identities = 85/253 (33%), Positives = 135/253 (53%), Gaps = 11/253 (4%) Query: 4 LEGKSALITGSARGIGRAFAQAYIAEGATVAIADIDLQRAQATAAELGPQAYAVAMDVTD 63 ++ K+ LITG A GIG A + + EG V D D + + A EL + + V D Sbjct: 1 MKNKTILITGGASGIGLAMTKRFAEEGGNVYFIDYDQKTGEKVAEELTSKGHRVTFLQGD 60 Query: 64 QASIDGAITAVVAQAGKLDILINNAALFDLAPIVDITRDSYDRLFSINVAGTLFTLQAAA 123 + + + + +G +D+L+NNA + + + + + +DRL+ +NV G ++ A+ Sbjct: 61 VSQTEEMKQTISSISGSIDVLVNNAGISHVGNLENTAEEDFDRLYQVNVKG-IYNCSLAS 119 Query: 124 RQMIRQGHGGKIINMASQAGRRGEPLVAIYCATKAAVISLTQSAGLNLIKQGINVNAIAP 183 +++ GG IINMAS A G P Y TK AV S+T S + ++ I VN+IAP Sbjct: 120 LPKMKE-KGGSIINMASVASTMGLPDRFAYSMTKGAVFSMTLSMARDYVEYNIRVNSIAP 178 Query: 184 GVVDGEHWDGVDALFAKHEGLAPGEKKQ---RVGAEVPFGRMGTAEDLTGMAIFLASKEA 240 G V H VD AK+ PG++K+ ++ A P GRMG E++ MA++L+S EA Sbjct: 179 GRV---HTPFVDGFLAKN---YPGKEKEMFDKLAATQPIGRMGKPEEIAAMAVYLSSDEA 232 Query: 241 DYVVAQTYNVDGG 253 ++ Y +DGG Sbjct: 233 SFLTGGNYPIDGG 245 Lambda K H 0.318 0.133 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 251 Length adjustment: 24 Effective length of query: 233 Effective length of database: 227 Effective search space: 52891 Effective search space used: 52891 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory