Align Sodium:dicarboxylate symporter (characterized, see rationale)
to candidate Echvi_3159 Echvi_3159 Na+/H+-dicarboxylate symporters
Query= uniprot:A1S570 (437 letters) >FitnessBrowser__Cola:Echvi_3159 Length = 449 Score = 258 bits (660), Expect = 2e-73 Identities = 145/404 (35%), Positives = 239/404 (59%), Gaps = 15/404 (3%) Query: 14 KILIGMGAGILIGLLLRNFFGGSEWVQDYITEGFFHVIGTIFINSLKMLVVPLVFISLVC 73 K++I + G+ GLLL G I + + G +F+ ++M+++PL+ S++ Sbjct: 27 KVIIALLLGVGFGLLLSPQNGWISKETADIAGNWLALPGVLFLKLVQMIMIPLIVASIIT 86 Query: 74 GTCSLSEPSKLGRLGGKTLAFYLFTTAIALVVAISAAVLVQPGN-----ASLASESMQYS 128 G S ++ L +LGG L ++L TT +++ + + + +PG A + Sbjct: 87 GIAS-NDKDSLKKLGGGVLLYFLGTTIVSVSIGTILSQIFRPGRFLHQQALKEHNEITAV 145 Query: 129 AKEAPSLA-------DVLINIVPSNPMKALSEGNMLQIIIFAVIFGFAISHI-GERGRRV 180 + + P L+ D + N++P NP+ ++ G ML I+IF +I G A+ + + R V Sbjct: 146 STDEPELSFGVETIPDAISNLLPENPLASMVSGEMLSIVIFTIIIGVAVLSLENDLLRPV 205 Query: 181 AALFDDLNEVIMRVVTLIMQLAPYGVFALMGKLALTLGMETLESVIKYFMLVLVVLLFHG 240 L + EV M VV M L P VF LM +L ++G+ +L + Y +VL+ LLF Sbjct: 206 KLLLSAIQEVCMTVVKWSMLLVPIAVFGLMAQLTSSVGLSSLSGLTYYVGVVLLGLLFL- 264 Query: 241 FVVYPTLLKLFSGLSPLMFIRKMRDVQLFAFSTASSNATLPVTMEASEHRLGADNKVASF 300 + Y L+ L +P+ F++K+RDVQL AFST SS A +P++++ +E +L D +++F Sbjct: 265 VIFYLGLIVLLGKANPMHFLKKIRDVQLLAFSTTSSAAVMPLSLQTAEEKLKVDKTISNF 324 Query: 301 TLPLGATINMDGTAIMQGVATVFIAQVFGIDLTITDYAMVVMTATLASIGTAGVPGVGLV 360 +P+GAT+NMDGTA+ Q + T+FIAQ +G+++++ + +V++T ASIGT +PG G+V Sbjct: 325 IIPIGATVNMDGTALYQTITTLFIAQAYGLEMSLLNIIVVIVTIVAASIGTPAIPGGGVV 384 Query: 361 MLAMVLNQVGLPVEGIALILGVDRMLDMVRTAVNVTGDTVATVV 404 +LA VL VG+P EGI +I+GV+R+L M RTAVNV GD A +V Sbjct: 385 ILASVLGSVGIPAEGIIIIIGVERLLGMFRTAVNVMGDLTACMV 428 Lambda K H 0.325 0.139 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 437 Length of database: 449 Length adjustment: 32 Effective length of query: 405 Effective length of database: 417 Effective search space: 168885 Effective search space used: 168885 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory