Align scyllo-inosose 3-dehydrogenase; 2-keto-myo-inositol dehydrogenase; EC 1.1.1.- (characterized)
to candidate Echvi_3219 Echvi_3219 Zn-dependent alcohol dehydrogenases
Query= SwissProt::Q9WYP3 (395 letters) >FitnessBrowser__Cola:Echvi_3219 Length = 343 Score = 93.2 bits (230), Expect = 1e-23 Identities = 82/271 (30%), Positives = 122/271 (45%), Gaps = 36/271 (13%) Query: 40 VRVEEVPEPRIEKPTE--IIIKVKACGICGSDVHMAQTDEEGYILYPGLTGFPVTLGHEF 97 +++EE+P ++ P E I+++V A G+C +D+H A D +P P+ GHE Sbjct: 18 LKIEEIP---VKAPNENQILVQVMASGVCHTDLHAADGD------WPVKPRLPLIPGHEG 68 Query: 98 SGVVVEAGPEAINRRTNKRFEIGEPVCAEEMLWCGHCRPCAEGFPNHCENLNELGFNVDG 157 G V G N T + +G P CGHC C G+ CE+ G++VDG Sbjct: 69 IGYVAAVGSNVKN--TKEGDIVGVPWLYSA---CGHCEHCITGWETLCESQVNGGYSVDG 123 Query: 158 AFAEYVKVDAKYAWSLRELEGVYEGDRLFLAGSLVEPTSVAYNAVIVRGG----GIRPGD 213 +AEYV D Y G + G A V+ + V V G +RPG Sbjct: 124 GYAEYVLADPNYV-------GRFSG-----AIDFVQMAPILCAGVTVYKGLKETEVRPGQ 171 Query: 214 NVVILGGGPIGLAAVAILKHAGASKVILSEPSEVRRNLAKELGADHVIDPTKENFVEAVL 273 V I G G +G AV K G V+ + S+ + NLAK+LGAD V++ + V Sbjct: 172 WVAISGIGGLGHVAVQYAKAMGL-HVLAVDVSDDKLNLAKKLGADRVVNGKNPDEVMNAR 230 Query: 274 DYTNGLGAKLFLEATGVPQLVWPQIEEVIWR 304 T G+ L T V + + Q +++ R Sbjct: 231 KETGGVHGVL---VTAVSPVAFRQALDLLRR 258 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 343 Length adjustment: 30 Effective length of query: 365 Effective length of database: 313 Effective search space: 114245 Effective search space used: 114245 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory