Align Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized)
to candidate Echvi_3705 Echvi_3705 acetyl-CoA acetyltransferases
Query= SwissProt::Q8VPF1 (401 letters) >FitnessBrowser__Cola:Echvi_3705 Length = 393 Score = 251 bits (641), Expect = 3e-71 Identities = 158/402 (39%), Positives = 232/402 (57%), Gaps = 14/402 (3%) Query: 3 REVYICDAVRTPIGRFGGSLAAVRADDLAAVPVKALVERNPQVDWSQLDEVYLGCANQAG 62 +EVYI AVRTP+G FGG L+ + A +L A +K + R QV Q+DEV +G A Sbjct: 2 KEVYIISAVRTPLGSFGGKLSGLTAVELGAQAIKGALGR-AQVTPEQVDEVIMGNVLSAN 60 Query: 63 EDNRNVARMALLLAGLPDSVPGVTLNRLCASGMDAVGTAFRAIASGEAELVIAGGVESMS 122 + AR A + AG+ VP T+N++CASGM +V A ++I +G++++++AGG+ESMS Sbjct: 61 L-GQAPARQAAIGAGIGYHVPCTTVNKVCASGMKSVMFAAQSIMTGQSDIIVAGGMESMS 119 Query: 123 RAPYVMGKADSA--FGRGQKIEDTTIGWRFINPLMKAQYGVDAMPETADNVADDYKVSRA 180 PY + KA FG G+ ++ + L + Y M ADN A + +SR Sbjct: 120 NVPYYIPKARFGYKFGNGEFVDGLAK-----DGLHEVYYNFP-MGNCADNTAKEKNISRE 173 Query: 181 DQDAFALRSQQLAGRAQAAGYFAEEIVPVVIKGKKGETV-VDADEHLRPDTTLEALAKLK 239 QD +A++S + A A A F +E++PV K +KGE++ VD DE + + E + L+ Sbjct: 174 AQDEYAIQSYRRAAEAWKAQAFQDEVIPVTFKSRKGESITVDEDEEYQ-NVLFEKIPSLR 232 Query: 240 PVNGPDKTVTAGNASGVNDGSVALILASAEAVKKHGLKARAKVLGMASAGVAPRVMGIGP 299 PV + TVTA NAS +NDG+ AL+L S E + GL+ AK+LG A A P P Sbjct: 233 PVFDKEGTVTAANASTMNDGAAALVLMSKEKAEALGLQPVAKILGFADAATDPIWFTTAP 292 Query: 300 VPAVRKLLERLNLSVADFDVIELNEAFAAQGLAVTRELGIADDDARVNPNGGAIALGHPL 359 A+ K L+ + D E+NEAF+A LA +EL I +D R+N GGA++LGHPL Sbjct: 293 ALAIPKALKNAGIQAEAVDYYEINEAFSAVALANQQELNIPND--RLNVFGGAVSLGHPL 350 Query: 360 GASGARLVLTAVHQLEKSGGQRGLCTMCVGVGQGVALAVERV 401 GASGAR++ T L + GG+ G+ +C G G A+ +E + Sbjct: 351 GASGARIMATLHSVLRQKGGKIGVAGICNGGGGASAMVIENL 392 Lambda K H 0.317 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 393 Length adjustment: 31 Effective length of query: 370 Effective length of database: 362 Effective search space: 133940 Effective search space used: 133940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory