Align 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized)
to candidate Echvi_3770 Echvi_3770 2-keto-3-deoxy-6-phosphogluconate aldolase
Query= BRENDA::D4GV57 (219 letters) >FitnessBrowser__Cola:Echvi_3770 Length = 214 Score = 125 bits (313), Expect = 8e-34 Identities = 69/198 (34%), Positives = 112/198 (56%), Gaps = 3/198 (1%) Query: 18 VVAVMRGADADTIIDVADALHEGGVTAYEITADNPDAMDLIREVSASFSDNEAIVGAGTA 77 ++A++R +DA T+ + L +GGV EIT ++PD I+E + D ++GAGT Sbjct: 17 LIAILRVSDAGTLPVLIAGLVKGGVKVLEITTNSPDYAAQIKENRQLYPD--ILIGAGTV 74 Query: 78 LDAPTANAAIQAGAEFVVGPNFDEGVVETCNRYGTLVAPGIMTPTEATDAYSAGADLVKV 137 ++ +A AI AGA+F+V PN GV+ + +G V G +TPTE A GAD++K+ Sbjct: 75 INEASAKEAIAAGAQFLVSPNTHVGVISLAHAHGIPVIMGALTPTEIGLALENGADMIKL 134 Query: 138 FPASSLGPGHLKSMKGPLPQIPMMPTGGVGLDNAADYIEAGAVVVGAGGALMDDEAIENG 197 FPA +GPG+LKS+K P + GG+ L+ ++EAGA +G G L ++ Sbjct: 135 FPAGDVGPGYLKSIKAPFDNARIFAVGGIHLETIHSWMEAGADGIGLGSVLTQLAGLKLT 194 Query: 198 DFEAITETAREFSNIIDD 215 + E + R+++ I + Sbjct: 195 E-EVVAHNVRKYTEKIKE 211 Lambda K H 0.314 0.133 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 219 Length of database: 214 Length adjustment: 22 Effective length of query: 197 Effective length of database: 192 Effective search space: 37824 Effective search space used: 37824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory