Align Glucosamine-6-phosphate deaminase; EC 3.5.99.6; GlcN6P deaminase; GNPDA; Glucosamine-6-phosphate isomerase (uncharacterized)
to candidate Echvi_3893 Echvi_3893 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase
Query= curated2:Q0SP13 (268 letters) >FitnessBrowser__Cola:Echvi_3893 Length = 775 Score = 81.6 bits (200), Expect = 5e-20 Identities = 49/144 (34%), Positives = 75/144 (52%), Gaps = 2/144 (1%) Query: 114 LEKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIKTLTQDTIIANSRF 173 ++K C EYE+KI+ GGI F+GGIGPDGHIAFN GS + S TR+ +T + Sbjct: 192 IDKWCGEYEQKIREKGGIGFFLGGIGPDGHIAFNTRGSDIFSTTRLTETNFETQAVAAGD 251 Query: 174 FEGNVNKVPKSALTVGIGTIMDSQEI--LIIVNGHNKARALKHAIEKGINHMWTISALQL 231 G + +T+G+ TI+ + E +II G KA+ +K ++E + ++ + LQ Sbjct: 252 LGGIEVSANRLVITIGLDTIVYNPEAVGIIIAAGEAKAQIVKDSLETDLTNIHPATVLQK 311 Query: 232 HKNAIIVSDKNATYELKVGTVEYF 255 KN K +L Y+ Sbjct: 312 LKNGRFYLTKGGASKLTDSINTYY 335 Lambda K H 0.317 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 432 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 775 Length adjustment: 33 Effective length of query: 235 Effective length of database: 742 Effective search space: 174370 Effective search space used: 174370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory