Align Glucokinase; ATP-dependent glucokinase; ATP-GLK; Glucose kinase; EC 2.7.1.2 (characterized)
to candidate Echvi_3894 Echvi_3894 Transcriptional regulator/sugar kinase
Query= SwissProt::Q9X1I0 (317 letters) >FitnessBrowser__Cola:Echvi_3894 Length = 291 Score = 130 bits (328), Expect = 3e-35 Identities = 92/308 (29%), Positives = 147/308 (47%), Gaps = 33/308 (10%) Query: 6 LIGVDLGGTTFSVGLVSEDGKILKKVTRDTLVENGKEDVIRRIAETILEVSDGEEAPYVG 65 ++G+D+GGT+ + G++ +DG++++K T + +E ++ IA+ I E +G Sbjct: 7 ILGLDIGGTSINAGIM-KDGELIEKREIPTPSQEPQEVILSTIADFIASYFS-HEIDGIG 64 Query: 66 IGSPGSIDRENGIVRFSPNFPDWHNVPLTDELAKRTGKKVFLENDANAFVLGEKWFGAGR 125 IG PG +D E GIV N P ++ V L D L + K V++ NDAN F LGE FG Sbjct: 65 IGIPGLVDAEKGIVYNLENIPAFNKVALKDYLERTLEKPVYINNDANCFALGEYKFGGAN 124 Query: 126 GHDHIVALTLGTGIGGGVVTHGYLLTGRDGIGAELGHVVVEPNGPMCNCGTRGCLEAVAS 185 H H+V +TLGTGIG GV+T+G L G +C G G + Sbjct: 125 KHRHMVGITLGTGIGTGVITNGELYPGF-----------------LCGAGEWGGVP---- 163 Query: 186 ATAIRRFLREGYKKYHSSLVYKLAGSPEKADAKHLFDAARQGDRFALMIRDRVVDALARA 245 +L ++ Y SS ++ AK L A +GD+ AL + + Sbjct: 164 ------YLDSNFENYCSSKFFR---KLHHTTAKKLAAKAAEGDQEALKLFYEYGTHIGNL 214 Query: 246 VAGYIHIFNPEIVIIGGGISRAGEILFGPLREKVVDYIMPSFVGTYEVVASPLVEDAGIL 305 + + + PE ++IGG I +A L+E V + S + S +D+ I+ Sbjct: 215 IKYILFTYAPEAIVIGGSIRKAFPYFSKGLKETVETFPYSSISDNLTIYTSSF-DDSAIM 273 Query: 306 GAASIIKE 313 GAA+++ E Sbjct: 274 GAAALVTE 281 Lambda K H 0.320 0.142 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 291 Length adjustment: 27 Effective length of query: 290 Effective length of database: 264 Effective search space: 76560 Effective search space used: 76560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory