Align Galactitol 2-dehydrogenase; GDH; Sorbitol dehydrogenase; SorbD; EC 1.1.1.16; EC 1.1.1.- (characterized)
to candidate Echvi_4610 Echvi_4610 3-oxoacyl-(acyl-carrier-protein) reductase
Query= SwissProt::A9CES4 (256 letters) >FitnessBrowser__Cola:Echvi_4610 Length = 248 Score = 136 bits (342), Expect = 5e-37 Identities = 90/253 (35%), Positives = 133/253 (52%), Gaps = 16/253 (6%) Query: 3 LNNKVALITGAARGIGLGFAQAFAAEGAKV---IIADIDIARATTSAAA-IGPAAKAVKL 58 L K ALITGA++GIG A +A EGA V ++ ++ +A A G AK + Sbjct: 4 LTGKTALITGASKGIGRAIALKYAQEGANVAFTFLSSVEKGQALEKELAEFGVKAKGFRS 63 Query: 59 DVTDLAQIDAVVKAVDEEFGGIDILVNNAAIFDMAPINGITEESYERVFDINLKGPMFMM 118 D +D + +V V +EFG +D+L+NNA + + + EE+++ V +INLK + Sbjct: 64 DASDFKAAEELVNEVVKEFGALDVLINNAGVTRDNLLMRMNEEAWDDVMNINLKSCFNTV 123 Query: 119 KAVSNVMIARARGGKIINMASQAGRRGEALVTLYCASKAAIISATQSAALALVKHGINVN 178 KA + ++ + + G IIN+ S G +G A Y ASKA II T+S AL L GI N Sbjct: 124 KAATRTLM-KQKAGSIINITSVVGIKGNAGQANYAASKAGIIGFTKSVALELGSRGIRSN 182 Query: 179 AIAPGVVDGEHWEVVDAHFAKWEGLKPGEKKAAVAKSVPIGRFATPDDIKGLAVFLASAD 238 A+APG ++ E EV+D E G + A +P+ R P+++ VFL S Sbjct: 183 AVAPGFIETEMTEVLD------EKTVQGWRDA-----IPMKRGGQPEEVANACVFLGSDM 231 Query: 239 SDYILAQTYNVDG 251 S Y+ Q VDG Sbjct: 232 SSYVSGQVIQVDG 244 Lambda K H 0.319 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 248 Length adjustment: 24 Effective length of query: 232 Effective length of database: 224 Effective search space: 51968 Effective search space used: 51968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory