Align N-succinyldiaminopimelate-aminotransferase (EC 2.6.1.17) (characterized)
to candidate GFF1219 PS417_06195 succinyldiaminopimelate aminotransferase
Query= metacyc::MONOMER-6501 (397 letters) >FitnessBrowser__WCS417:GFF1219 Length = 399 Score = 407 bits (1045), Expect = e-118 Identities = 213/395 (53%), Positives = 262/395 (66%), Gaps = 4/395 (1%) Query: 1 MNPRLDALHPYPFEKLRALLADAGKPTHDLPPINLSIGEPKHAAPACVGQAIAANLAGLS 60 MN L+ L PYPFEKLRALL P D PI LSIGEPKH +P V +A++ NL ++ Sbjct: 1 MNNALNQLQPYPFEKLRALLGSV-TPNPDKRPIALSIGEPKHKSPTFVAEALSNNLDQMA 59 Query: 61 VYPSTKGEPALRQAISQWLSRRYSIPAP--DPESEVLPVLGSREALFAFAQTVIDPSAGA 118 VYP+T G PALR+AI W RR+++P DP +LPV G+REALFAF QTV++ A Sbjct: 60 VYPTTLGIPALREAIGAWCERRFNVPKGWLDPARNILPVNGTREALFAFTQTVVNRGDDA 119 Query: 119 LVVCPNPFYQIYEGAALLAGATPYYVNADPARDFGLRTGRVPDEVWRRTQLVFVCSPGNP 178 LVV PNPFYQIYEGAA LAGA P+Y+ A F V ++W+R Q++F+CSPGNP Sbjct: 120 LVVSPNPFYQIYEGAAFLAGAKPHYLPCLDANGFNPDFEAVTPDIWKRCQILFLCSPGNP 179 Query: 179 AGNVMSLEEWRTLFELSDRHGFVIAAYECYSEIYLDEDTPPLGSLQAARRLGRDRYTNLV 238 G ++ ++ + L L+D + FVIAA ECYSE+Y DE +PP G L A LGR + V Sbjct: 180 TGALIPVDTLKKLIALADEYDFVIAADECYSELYFDEQSPPPGLLSACVELGRQDFKRCV 239 Query: 239 AFSSLSKRSNVPGMRSGFVAGDAALLARFLLYRTYHGSAMSPVVSAASIAAW-SMRRMCR 297 F SLSKRSN+PG+RSGFVAGDA +L FLLYRTYHG AM ASIAAW + Sbjct: 240 VFHSLSKRSNLPGLRSGFVAGDADILKAFLLYRTYHGCAMPVQTQLASIAAWQDEAHVLA 299 Query: 298 KTAQYRAKFEAVLPILQNVLDVRAPQASFYLWAGTPGSDTAFARELYGRTGVTVLPGSLL 357 YR KF+AVL IL+ VLDV +P FYLW G D F R+L+ VTV+PGS L Sbjct: 300 NRDLYREKFDAVLAILKPVLDVESPDGGFYLWPNVNGDDAGFCRDLFVEEHVTVVPGSYL 359 Query: 358 AREAHNANPGQGRIRIALVAPLDQCVQAAERIAHF 392 +RE NPG GR+R+ALVAPL +CV+AAERI F Sbjct: 360 SREVDGFNPGAGRVRLALVAPLAECVEAAERIRDF 394 Lambda K H 0.321 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 509 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 399 Length adjustment: 31 Effective length of query: 366 Effective length of database: 368 Effective search space: 134688 Effective search space used: 134688 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate GFF1219 PS417_06195 (succinyldiaminopimelate aminotransferase)
to HMM TIGR03538 (dapC: succinyldiaminopimelate transaminase (EC 2.6.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03538.hmm # target sequence database: /tmp/gapView.28396.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03538 [M=395] Accession: TIGR03538 Description: DapC_gpp: succinyldiaminopimelate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-208 678.0 0.0 2.2e-208 677.8 0.0 1.0 1 lcl|FitnessBrowser__WCS417:GFF1219 PS417_06195 succinyldiaminopimel Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF1219 PS417_06195 succinyldiaminopimelate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 677.8 0.0 2.2e-208 2.2e-208 1 395 [] 1 395 [. 1 395 [. 1.00 Alignments for each domain: == domain 1 score: 677.8 bits; conditional E-value: 2.2e-208 TIGR03538 1 mnpnlerlkpyPfeklaellkdvtppadleeialsiGePkhatPafvlealvenleelskyPttkGlpelreaia 75 mn++l++l+pyPfekl++ll +vtp+ d+++ialsiGePkh++P+fv+eal +nl++++ yPtt G+p+lreai lcl|FitnessBrowser__WCS417:GFF1219 1 MNNALNQLQPYPFEKLRALLGSVTPNPDKRPIALSIGEPKHKSPTFVAEALSNNLDQMAVYPTTLGIPALREAIG 75 9************************************************************************** PP TIGR03538 76 eWlerrfelpag.vdperqvlPvnGtrealfafvqavidraekalvvlPnPfyqiyeGaallagaepyflnctae 149 +W+errf++p+g +dp+r++lPvnGtrealfaf+q+v++r ++alvv+PnPfyqiyeGaa+laga+p++l+c ++ lcl|FitnessBrowser__WCS417:GFF1219 76 AWCERRFNVPKGwLDPARNILPVNGTREALFAFTQTVVNRGDDALVVSPNPFYQIYEGAAFLAGAKPHYLPCLDA 150 *************************************************************************** PP TIGR03538 150 ngfkpdfdavpeevWkrvqllfvcsPgnPtGavlsleelkklleladkydfiiasdecyselyldeaeaPvGlle 224 ngf+pdf+av ++Wkr+q+lf+csPgnPtGa++++++lkkl++lad+ydf+ia+decysely+de+++P Gll+ lcl|FitnessBrowser__WCS417:GFF1219 151 NGFNPDFEAVTPDIWKRCQILFLCSPGNPTGALIPVDTLKKLIALADEYDFVIAADECYSELYFDEQSPPPGLLS 225 *************************************************************************** PP TIGR03538 225 aaaelGrddfkrllvfhslskrsnvPGlrsGfvaGdaellkeflryrtyhGcampiavqlasiaaWedekhvren 299 a+ elGr+dfkr++vfhslskrsn+PGlrsGfvaGda++lk+fl yrtyhGcamp+++qlasiaaW+de+hv +n lcl|FitnessBrowser__WCS417:GFF1219 226 ACVELGRQDFKRCVVFHSLSKRSNLPGLRSGFVAGDADILKAFLLYRTYHGCAMPVQTQLASIAAWQDEAHVLAN 300 *************************************************************************** PP TIGR03538 300 ralyrekfaavleilgavldlelPdasfylWlkvpdgddeafaralyeeenvkvlpGrylsreaegvnPGegrvr 374 r+lyrekf+avl+il++vld+e Pd++fylW++v +gdd+ f+r+l+ ee+v+v+pG+ylsre++g nPG+grvr lcl|FitnessBrowser__WCS417:GFF1219 301 RDLYREKFDAVLAILKPVLDVESPDGGFYLWPNV-NGDDAGFCRDLFVEEHVTVVPGSYLSREVDGFNPGAGRVR 374 **********************************.8*************************************** PP TIGR03538 375 lalvaeleecveaaerikkll 395 lalva+l+ecveaaeri++++ lcl|FitnessBrowser__WCS417:GFF1219 375 LALVAPLAECVEAAERIRDFI 395 ******************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (395 nodes) Target sequences: 1 (399 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.33 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory