Align Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic; AGPR; N-acetyl-glutamate semialdehyde dehydrogenase; NAGSA dehydrogenase; EC 1.2.1.38 (characterized)
to candidate GFF1682 PGA1_c17050 N-acetyl-gamma-glutamyl-phosphate reductase ArgC
Query= SwissProt::Q93Z70 (401 letters) >FitnessBrowser__Phaeo:GFF1682 Length = 342 Score = 361 bits (926), Expect = e-104 Identities = 180/343 (52%), Positives = 238/343 (69%), Gaps = 5/343 (1%) Query: 60 RIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVKD 119 ++ +LGASGYTGAE+VRL++ HP ++ ++A+RKAG +M VFPHLR +LP L + + Sbjct: 4 KVAILGASGYTGAELVRLISQHPTIEIAALSAERKAGMTMAQVFPHLRHLELPVLCKIGE 63 Query: 120 ADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKAVELQ 179 DF+ +D FC LPH T+QE+I LP LKIVDLSADFRLR+ EYE+WYG PH A+ Q Sbjct: 64 IDFTGIDLCFCALPHKTSQEVIAALPQDLKIVDLSADFRLRDPDEYEKWYGNPHAALAQQ 123 Query: 180 KEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGVSGA 239 KE VYGL+E RE+IK ARLVA GC T Q L PL+ + +I ++II+D K VSGA Sbjct: 124 KEAVYGLSEFYREEIKSARLVAGTGCNAATGQFALRPLIASGVIDLDDIILDLKCAVSGA 183 Query: 240 GRGAKEANLYSEIAEGISSYGV-TRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQ 298 GR KE L++E++EG Y V HRH+ E +Q S +A V V FTPHL+P RG+ Sbjct: 184 GRSLKENLLHAELSEGYHGYAVGGTHRHLGEFDQEFSKIAGRPVKVQFTPHLVPANRGIL 243 Query: 299 STIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDRIP 358 +T+YV+ + +HQ L T+Y DE F+++L G P T ++RGSN+CH+ V DRI Sbjct: 244 ATVYVK----GDAQTIHQTLATAYADEPFIELLPFGEAPSTRHIRGSNFCHIGVAADRIE 299 Query: 359 GRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP 401 GR I+I+ +DNL KG+SGQALQN N+MLG ETTGL+ PLFP Sbjct: 300 GRTIVIAALDNLTKGSSGQALQNANLMLGEEETTGLMMAPLFP 342 Lambda K H 0.318 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 342 Length adjustment: 30 Effective length of query: 371 Effective length of database: 312 Effective search space: 115752 Effective search space used: 115752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate GFF1682 PGA1_c17050 (N-acetyl-gamma-glutamyl-phosphate reductase ArgC)
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01850.hmm # target sequence database: /tmp/gapView.6542.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01850 [M=345] Accession: TIGR01850 Description: argC: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-118 379.6 0.0 8.6e-118 379.4 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF1682 PGA1_c17050 N-acetyl-gamma-gluta Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF1682 PGA1_c17050 N-acetyl-gamma-glutamyl-phosphate reductase ArgC # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 379.4 0.0 8.6e-118 8.6e-118 2 345 .] 4 342 .] 3 342 .] 0.97 Alignments for each domain: == domain 1 score: 379.4 bits; conditional E-value: 8.6e-118 TIGR01850 2 kvaivGasGYtGaeLlrllakHpevevtklvssreagkklsevhphlkglvdlkleeleeeeileeadvvflAlph 77 kvai+GasGYtGaeL+rl+++Hp +e+++l ++r+ag ++++v+phl++l l+++ e + + +d+ f+Alph lcl|FitnessBrowser__Phaeo:GFF1682 4 KVAILGASGYTGAELVRLISQHPTIEIAALSAERKAGMTMAQVFPHLRHLELPVLCKIGEID-FTGIDLCFCALPH 78 8************************************************9998888887765.569********** PP TIGR01850 78 gvsaelvpellekgvkvidlSadfRlkdaevYekwYgkkhekeelleeavYGlpElnreeikkaklianPGCyaTa 153 ++s+e++ ++l +++k++dlSadfRl+d+++YekwYg++h++ ++++eavYGl+E++reeik+a+l+a GC+a + lcl|FitnessBrowser__Phaeo:GFF1682 79 KTSQEVI-AALPQDLKIVDLSADFRLRDPDEYEKWYGNPHAALAQQKEAVYGLSEFYREEIKSARLVAGTGCNAAT 153 *******.667999************************************************************** PP TIGR01850 154 alLalaPllkekliepksiivdaksGvSgAGrkasekslfaevnenlkpYkvt.kHrHtpEieqelsklaekkvkv 228 + al Pl+++++i+ ++ii d k +vSgAGr+ +e+ l+ae++e + Y+v +HrH E qe sk+a++ vkv lcl|FitnessBrowser__Phaeo:GFF1682 154 GQFALRPLIASGVIDLDDIILDLKCAVSGAGRSLKENLLHAELSEGYHGYAVGgTHRHLGEFDQEFSKIAGRPVKV 229 ****************************************************99********************** PP TIGR01850 229 sftphlvpmtrGilatiyaklkkelteeelrklyeevYedepfvrvlkegelPstkavlgsnfvdigvavdeetkr 304 +ftphlvp rGilat+y+k ++ ++++++++++Y+depf+++l+ ge+Pst++++gsnf++igva d+ ++r lcl|FitnessBrowser__Phaeo:GFF1682 230 QFTPHLVPANRGILATVYVKGDA----QTIHQTLATAYADEPFIELLPFGEAPSTRHIRGSNFCHIGVAADRIEGR 301 *******************9988....88*********************************************** PP TIGR01850 305 vvvvsaiDNLvKGaagqAvqnlNlmlgfdetegLeklpllp 345 +v++a+DNL+KG +gqA+qn Nlmlg +et+gL + pl+p lcl|FitnessBrowser__Phaeo:GFF1682 302 TIVIAALDNLTKGSSGQALQNANLMLGEEETTGLMMAPLFP 342 **************************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (345 nodes) Target sequences: 1 (342 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.19 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory