Align Arginine transport ATP-binding protein ArtM (characterized)
to candidate GFF197 PGA1_c02010 glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD
Query= SwissProt::P54537 (240 letters) >FitnessBrowser__Phaeo:GFF197 Length = 263 Score = 266 bits (681), Expect = 2e-76 Identities = 131/239 (54%), Positives = 175/239 (73%) Query: 2 IKVEKLSKSFGKHEVLKNISTTIAEGEVVAVIGPSGSGKSTFLRCLNLLEKPNGGTITIK 61 I++ ++K +G VL++I+ T+ +GE + + GPSGSGKST +RCLN LE+ G I + Sbjct: 23 IEINNMNKWYGSFHVLRDINLTVNQGERIVIAGPSGSGKSTLIRCLNALEEHQQGNIMVD 82 Query: 62 DTEITKPKTNTLKVRENIGMVFQHFHLFPHKTVLENIMYAPVNVKKESKQAAQEKAEDLL 121 TE++ N K+R +GMVFQHF+LFPH T+LEN AP+ V+K K+ A+E+A L Sbjct: 83 GTELSNDLKNIDKIRSEVGMVFQHFNLFPHLTILENCTLAPIWVRKTPKKEAEERAMHFL 142 Query: 122 RKVGLFEKRNDYPNRLSGGQKQRVAIARALAMNPDIMLFDEPTSALDPEMVKEVLQVMKE 181 KV + ++ + YP LSGGQ+QRVAIAR+L M P IMLFDEPTSALDPEM+KEVL M E Sbjct: 143 EKVKIPDQAHKYPGMLSGGQQQRVAIARSLCMMPRIMLFDEPTSALDPEMIKEVLDTMIE 202 Query: 182 LVETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKEFFMSPKSKRAQDFLEKIL 240 L E GMTM+ VTHEMGFA++VA+RV+FMD G IVE P+EFF +P+S+R + FL +IL Sbjct: 203 LAEEGMTMLCVTHEMGFARQVANRVIFMDAGQIVEQNEPEEFFNNPQSERTKLFLSQIL 261 Lambda K H 0.317 0.134 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 263 Length adjustment: 24 Effective length of query: 216 Effective length of database: 239 Effective search space: 51624 Effective search space used: 51624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory