Align class I fructose-bisphosphate aldolase/sedoheptulose-1,7-bisphosphate aldolase monomer (EC 4.1.2.13) (characterized)
to candidate GFF2360 PGA1_c23910 fructose-bisphosphate aldolase class 1
Query= metacyc::FBABSYN-MONOMER (300 letters) >FitnessBrowser__Phaeo:GFF2360 Length = 300 Score = 325 bits (834), Expect = 6e-94 Identities = 169/290 (58%), Positives = 211/290 (72%) Query: 10 QLKKMKSHPGFIAALDQSGGSTPGALADYGIEPNTYSGDDQMFALVHQMRTRIMTSPGFT 69 QL ++ + GFIAALDQSGGSTP ALA YG+ + Y DD+MF + +MR RI+T+P F Sbjct: 11 QLDRIANGKGFIAALDQSGGSTPKALALYGVTEDAYGNDDEMFGEIQKMRARIITAPDFN 70 Query: 70 GDRILAAILFEDTMNREVDGEPTANYLWQNKQIVPILKVDKGLAQEKDGSQLMKPIPQLD 129 D+IL AILFE TM+ +DG P YLW N +VP LKVDKGLA E D +Q MKP+P LD Sbjct: 71 SDKILGAILFEKTMDAAIDGTPVPAYLWDNCGVVPFLKVDKGLADEADDAQTMKPMPDLD 130 Query: 130 SLLMKAKKKGIFGTKMRSFIKHANPAGIEAIVDQQFELAQQIIAAGLVPIIEPEVDIHCS 189 +LL +A K GIFGTKMRS IK AN GI+ +V QQF + +QI AAGL+PIIEPEVDI+ + Sbjct: 131 ALLSRAVKAGIFGTKMRSVIKGANATGIKNVVGQQFIVGRQIAAAGLLPIIEPEVDINST 190 Query: 190 EKAQAEALLKQAMLKHLNQLPKGQWVMLKLTLPEQDNLYSNCIEHANVLRVVALSGGYSQ 249 KA+AEALLK A+L LN LP V LKLT+P + LY + HANV+RVVALSGGY+ Sbjct: 191 TKAEAEALLKDAILAELNALPADTKVALKLTIPTEAGLYDDLAAHANVVRVVALSGGYTT 250 Query: 250 AEANERLSRNHGVIASFSRALTEGLTAQQTDAEFNTMLDESIEKIYQASI 299 +A E+LS+N +IASFSRALTEGL +D ++N L +I+KIY+ASI Sbjct: 251 DDACEKLSQNKTMIASFSRALTEGLNVAMSDEDYNAALGSNIDKIYRASI 300 Lambda K H 0.316 0.132 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 300 Length adjustment: 27 Effective length of query: 273 Effective length of database: 273 Effective search space: 74529 Effective search space used: 74529 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory