Align Homoserine O-succinyltransferase; HST; EC 2.3.1.46; Homoserine transsuccinylase; HTS (uncharacterized)
to candidate GFF3215 HP15_3157 homoserine O-acetyltransferase
Query= curated2:A0LCI7 (394 letters) >FitnessBrowser__Marino:GFF3215 Length = 343 Score = 80.9 bits (198), Expect = 5e-20 Identities = 61/194 (31%), Positives = 86/194 (44%), Gaps = 18/194 (9%) Query: 27 LQLDGGTLLHSVDVSYETYGTLNQERSNAVLICHALSGNAHAAGYHSKDDKRPGWWDHYI 86 L L G LHS + Y G LN + N +++ G A AG H ++ Sbjct: 16 LPLTSGETLHSARLRYHRIGELNAPKDNLIMLPTYYGGAA--AGNHP-----------WV 62 Query: 87 GPGKPFDTNRYFVIASNNLGGCDGTTGPSSIDPATGMPYGLNFPMITIGDIVRVQHALVR 146 P D +RY ++ LG + ++ PS+ A G P FP +++ D V +Q LV Sbjct: 63 RGNSPLDPDRYCIVIPALLGAGESSS-PSNTAGAQGGP---GFPSVSLYDNVMLQKRLVE 118 Query: 147 QL-GIERLMAVVGGSMGGMQALQWALDYPHMVPASVIIAAAPRLTAQNIAFNAVARQAIM 205 + G R+ V+G SMGGMQALQW +P V A + R N F + A+ Sbjct: 119 DIFGDARIALVMGWSMGGMQALQWGCLFPTQVRAVLATCCTARCYPHNRVFLEGVKAALT 178 Query: 206 ADPHFNGGDYYTLP 219 D F G Y T P Sbjct: 179 CDHAFENGRYRTPP 192 Lambda K H 0.320 0.136 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 343 Length adjustment: 30 Effective length of query: 364 Effective length of database: 313 Effective search space: 113932 Effective search space used: 113932 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory