Align Metal-independent phosphoserine phosphatase; iPSP; Phosphoglycerate mutase-like protein 3; EC 3.1.3.3 (characterized)
to candidate HSERO_RS02035 HSERO_RS02035 phosphoglycerate mutase
Query= SwissProt::F4KI56 (238 letters) >FitnessBrowser__HerbieS:HSERO_RS02035 Length = 214 Score = 125 bits (314), Expect = 7e-34 Identities = 76/206 (36%), Positives = 116/206 (56%), Gaps = 9/206 (4%) Query: 24 VTEIVLVRHGETTWNAAGRIQGQIESDLNEVGLKQAVAIAERLGKEERPVAVYSSDLKRA 83 +TEI+L+RHGET WN R+QG I+ LN G +Q +A+ E L E AV++SDL+RA Sbjct: 1 MTEILLIRHGETDWNVDKRLQGHIDIGLNAAGQRQVLALGEALAAEGID-AVFASDLQRA 59 Query: 84 KDTALMIAKTCFCPEVIEVPDLKERHVGSLQGLYWKEGAEKEPEAYSAFFSSQNDLEIPG 143 +DTA +A T I+ L+ER G+ +GL E + P+AY + + D P Sbjct: 60 RDTAQAVAGTAGLTVQIDA-GLRERCYGAFEGLRHSEIEARYPDAYRQWKARDPDFRYPA 118 Query: 144 G---GESFDQLADRSMDALEQIAKKHKGERVIVVTHGGVLRAIYLRITQASSAG----KL 196 G E+ + +RS+ A++++ + +V +VTHGGVL ++ +Q S A + Sbjct: 119 GERVAETMREFYERSVQAMQRVLASGRYGKVAIVTHGGVLECVHHWASQTSFAQPRTFDI 178 Query: 197 LNASVNVVHLRDQKWIIDSWSDVSHL 222 NASVN +H Q+ I SW ++ HL Sbjct: 179 FNASVNRLHWDGQRAHIRSWGEIGHL 204 Lambda K H 0.315 0.132 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 6 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 214 Length adjustment: 22 Effective length of query: 216 Effective length of database: 192 Effective search space: 41472 Effective search space used: 41472 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory