Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 (characterized)
to candidate HSERO_RS10790 HSERO_RS10790 succinyl-diaminopimelate desuccinylase
Query= SwissProt::Q9JYL2 (381 letters) >FitnessBrowser__HerbieS:HSERO_RS10790 Length = 375 Score = 477 bits (1227), Expect = e-139 Identities = 231/374 (61%), Positives = 281/374 (75%) Query: 4 TQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGDTKNIWLRRGTKAPVV 63 +++L L +EL+S SVTP+D+ CQ LAE L +GF E + G+ N+W R+GT P+V Sbjct: 2 SKTLALTQELMSLSSVTPEDKGCQARLAELLTPLGFVCETIQSGEVTNLWARKGTAQPLV 61 Query: 64 CFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAKHPNH 123 FAGHTDVVPTGP+EKW S PF+P R+GRLYGRGA+DMKTSIA V ACE F A HP+H Sbjct: 62 VFAGHTDVVPTGPLEKWQSHPFQPTLREGRLYGRGASDMKTSIAAMVVACEEFTAAHPDH 121 Query: 124 QGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRGSL 183 +GSI LITSDEEG A+DGT V + LKAR E +DYCIVGEPT+ LGDMIKNGRRG++ Sbjct: 122 KGSIGFLITSDEEGPAIDGTVVVCNALKARGEQLDYCIVGEPTSAKTLGDMIKNGRRGTM 181 Query: 184 SGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGGTG 243 SG LTVKG QGHIAYP LA NP+H APAL EL E WD GNEY+ PTS+QISNI+GGTG Sbjct: 182 SGKLTVKGIQGHIAYPQLARNPIHQAAPALAELVAEQWDAGNEYYLPTSWQISNIHGGTG 241 Query: 244 ATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQYDLQWSCSGQPFLTQAGKLT 303 A+NVIPGE+ + FNFRFST ST GL+QRVHAILDKHG++YDL+W+ G PFLT G L+ Sbjct: 242 ASNVIPGEVMIDFNFRFSTASTVEGLQQRVHAILDKHGLEYDLKWTVGGLPFLTPRGDLS 301 Query: 304 DVARAAIAETCGIEAELSTTGGTSDGRFIKAIAQELIELGPSNATIHQINENVRLNDIPK 363 D AI + G++ ELSTTGGTSDGRFI I ++IE GP N +IH+I+E++ + I Sbjct: 302 DALSKAIKDETGLDTELSTTGGTSDGRFIAQICPQVIEFGPPNDSIHKIDEHIEVRYIDP 361 Query: 364 LSAVYEGILARLLA 377 L +Y L LLA Sbjct: 362 LKNIYRKTLENLLA 375 Lambda K H 0.317 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 470 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 375 Length adjustment: 30 Effective length of query: 351 Effective length of database: 345 Effective search space: 121095 Effective search space used: 121095 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate HSERO_RS10790 HSERO_RS10790 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.3874.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-164 531.5 0.0 6.3e-164 531.3 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS10790 HSERO_RS10790 succinyl-diaminopi Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS10790 HSERO_RS10790 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 531.3 0.0 6.3e-164 6.3e-164 3 370 .] 6 373 .. 4 373 .. 0.99 Alignments for each domain: == domain 1 score: 531.3 bits; conditional E-value: 6.3e-164 TIGR01246 3 elakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgteepvlvfaGhtDvvPaG 70 +l++eL+s+ svtP+d+g+q+ +ae L+ lgf +e+++ ++++nlwa++gt +p +vfaGhtDvvP+G lcl|FitnessBrowser__HerbieS:HSERO_RS10790 6 ALTQELMSLSSVTPEDKGCQARLAELLTPLGFVCETIQSGEVTNLWARKGTAQPLVVFAGHTDVVPTG 73 799***************************************************************** PP TIGR01246 71 elekWssdpfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGt 138 +lekW+s+pf+p+ r+G+lygrGa Dmk+s+aa+vva+e+f ++++dhkGs+++litsDeeg aidGt lcl|FitnessBrowser__HerbieS:HSERO_RS10790 74 PLEKWQSHPFQPTLREGRLYGRGASDMKTSIAAMVVACEEFTAAHPDHKGSIGFLITSDEEGPAIDGT 141 ******************************************************************** PP TIGR01246 139 kkvvetlkerdelidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavp 206 + v + lk+r e++dy++vgeP+s+k+lGD+ik+GrrG ++gkl++kGiqGh+aYP++a+nP+h+a+p lcl|FitnessBrowser__HerbieS:HSERO_RS10790 142 VVVCNALKARGEQLDYCIVGEPTSAKTLGDMIKNGRRGTMSGKLTVKGIQGHIAYPQLARNPIHQAAP 209 ******************************************************************** PP TIGR01246 207 vlkeliaiklDeGneffppsslqianieagtgasnviPgelkvkfnlrfssevseeelkskvekildk 274 +l+el+a+++D Gne++ p+s qi+ni++gtgasnviPge+ + fn+rfs+ +++e l+++v++ildk lcl|FitnessBrowser__HerbieS:HSERO_RS10790 210 ALAELVAEQWDAGNEYYLPTSWQISNIHGGTGASNVIPGEVMIDFNFRFSTASTVEGLQQRVHAILDK 277 ******************************************************************** PP TIGR01246 275 hkldYelewklsgepfltkegklikkvaeaieevlkkkpelstsGGtsDarfiaklgaevvelGlvnd 342 h+l+Y+l+w++ g pflt +g+l +++ +ai+ ++ +elst+GGtsD+rfia++ +v+e+G+ nd lcl|FitnessBrowser__HerbieS:HSERO_RS10790 278 HGLEYDLKWTVGGLPFLTPRGDLSDALSKAIKDETGLDTELSTTGGTSDGRFIAQICPQVIEFGPPND 345 ******************************************************************** PP TIGR01246 343 tihkvneavkiedleklsevyeklleel 370 +ihk++e++++ ++ l+++y+k+le+l lcl|FitnessBrowser__HerbieS:HSERO_RS10790 346 SIHKIDEHIEVRYIDPLKNIYRKTLENL 373 *************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (375 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.08 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory