Align Catechol 1,2-dioxygenase (EC 1.13.11.1) (characterized)
to candidate Pf1N1B4_5803 Catechol 1,2-dioxygenase (EC 1.13.11.1)
Query= reanno::pseudo13_GW456_L13:PfGW456L13_3822 (309 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5803 Length = 309 Score = 600 bits (1548), Expect = e-176 Identities = 294/309 (95%), Positives = 302/309 (97%) Query: 1 MNVKISHTAEVQKFLEEASGLLNDAGNPRTKALVYRILRDSVNIIEDLAVTPEEFWKAVN 60 MNVKISHTA QKFLE+ASGL N+AG+PR KAL+YRILRDSVNIIEDLAVTPEEFWKAVN Sbjct: 1 MNVKISHTASAQKFLEDASGLHNEAGDPRVKALIYRILRDSVNIIEDLAVTPEEFWKAVN 60 Query: 61 YLNVLGARQEAGLVVAGLGLEHYLDLLMDAEDEQAGKSGGTPRTIEGPLYVAGAPLSQGE 120 YLNVLGARQEAGLVVAGLGLEHYLDLLMDAEDEQAGK+GGTPRTIEGPLYVAGAPLS+GE Sbjct: 61 YLNVLGARQEAGLVVAGLGLEHYLDLLMDAEDEQAGKAGGTPRTIEGPLYVAGAPLSEGE 120 Query: 121 ARLDDGVDPGVTLFMQGRVFNTAGEPLAGAVVDVWHANTGGTYSYFDTTQSEFNLRRRIV 180 ARLDDGVDPGV LFMQG+V NTAGEPLAGAVVDVWHANTGGTYSYFDTTQSEFNLRRRIV Sbjct: 121 ARLDDGVDPGVVLFMQGQVRNTAGEPLAGAVVDVWHANTGGTYSYFDTTQSEFNLRRRIV 180 Query: 181 TDAEGRYRFRSIVPSGYGCPPDGPTQQLLDQLGRHGQRPAHVHFFISAPDHRHLTTQINL 240 TDAEGRYRFRSIVPSGYGCPPDGPTQQLLDQLGRHGQRPAH+HFFISAPDHRHLTTQINL Sbjct: 181 TDAEGRYRFRSIVPSGYGCPPDGPTQQLLDQLGRHGQRPAHIHFFISAPDHRHLTTQINL 240 Query: 241 DGDQYLHDDFAYATRDELIAKITFSDDQQRAAAHGVSGRFAEIDFDFTLQSSAQPEEQQR 300 DGDQYLHDDFAYATRDELIAKITFSDD QRAAAHGVSGRFAEIDFDFTLQSSAQPEEQQR Sbjct: 241 DGDQYLHDDFAYATRDELIAKITFSDDPQRAAAHGVSGRFAEIDFDFTLQSSAQPEEQQR 300 Query: 301 HERVRALED 309 HERVRALED Sbjct: 301 HERVRALED 309 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 501 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 309 Length adjustment: 27 Effective length of query: 282 Effective length of database: 282 Effective search space: 79524 Effective search space used: 79524 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate Pf1N1B4_5803 (Catechol 1,2-dioxygenase (EC 1.13.11.1))
to HMM TIGR02439 (catA: catechol 1,2-dioxygenase (EC 1.13.11.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02439.hmm # target sequence database: /tmp/gapView.29369.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02439 [M=285] Accession: TIGR02439 Description: catechol_proteo: catechol 1,2-dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-140 451.8 0.0 4.1e-140 451.6 0.0 1.0 1 lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5803 Catechol 1,2-dioxygenase (EC 1.1 Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5803 Catechol 1,2-dioxygenase (EC 1.13.11.1) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 451.6 0.0 4.1e-140 4.1e-140 2 285 .] 8 289 .. 7 289 .. 0.99 Alignments for each domain: == domain 1 score: 451.6 bits; conditional E-value: 4.1e-140 TIGR02439 2 tkevqallkkvagleqeggnarikqivlrvlsdlfkaiedlditedefwaaveylnklGqanel 65 t+ q++l+ ++gl++e g++r+k ++ r+l+d ++ iedl +t++efw+av+yln lG+++e+ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5803 8 TASAQKFLEDASGLHNEAGDPRVKALIYRILRDSVNIIEDLAVTPEEFWKAVNYLNVLGARQEA 71 66789*********************************************************** PP TIGR02439 66 gllaaGlGlehfldlrldaadakagleggtPrtieGPlyvaGapvseGfarlddgseddkaetl 129 gl++aGlGleh+ldl++da d++ag ggtPrtieGPlyvaGap+seG+arlddg d + +l lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5803 72 GLVVAGLGLEHYLDLLMDAEDEQAGKAGGTPRTIEGPLYVAGAPLSEGEARLDDGV--DPGVVL 133 ********************************************************..668*** PP TIGR02439 130 vlkGqvldaeGkpiagakvevwhanskGnysffdksqsefnlrrtiitdaeGkyrarsvvPvGy 193 +++Gqv++++G+p+aga+v+vwhan+ G+ys+fd +qsefnlrr+i+tdaeG+yr+rs+vP+Gy lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5803 134 FMQGQVRNTAGEPLAGAVVDVWHANTGGTYSYFDTTQSEFNLRRRIVTDAEGRYRFRSIVPSGY 197 **************************************************************** PP TIGR02439 194 gvppqgptqqllnllGrhGerPahvhffvsapgyrklttqinlegdkylyddfafatreglvae 257 g+pp+gptqqll++lGrhG+rPah+hff+sap +r+lttqinl+gd+yl+ddfa+atr++l+a+ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5803 198 GCPPDGPTQQLLDQLGRHGQRPAHIHFFISAPDHRHLTTQINLDGDQYLHDDFAYATRDELIAK 261 **************************************************************** PP TIGR02439 258 vkevedaaaakrrgvegrfaeiefdlel 285 +++ +d ++a+++gv grfaei+fd++l lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5803 262 ITFSDDPQRAAAHGVSGRFAEIDFDFTL 289 **************************87 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (309 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.03 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory