Align Ornithine carbamoyltransferase 1, anabolic; OTCase 1; Ornithine carbamoyltransferase 1, phaseolotoxin-sensitive; SOCT; EC 2.1.3.3 (characterized)
to candidate Pf6N2E2_5579 Ornithine carbamoyltransferase (EC 2.1.3.3)
Query= SwissProt::Q02047 (306 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5579 Length = 306 Score = 535 bits (1379), Expect = e-157 Identities = 267/306 (87%), Positives = 284/306 (92%) Query: 1 MNARHFLSMMDYTPDELLGLIRRGVELKDLRIRGELFEPLKNRVLGMIFEKSSTRTRLSF 60 M+ARHFLS+MD+TPDELLG+IRRGVELKDLR RG LFEPLKNRVLGMIFEKSSTRTR+SF Sbjct: 1 MSARHFLSLMDFTPDELLGVIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRISF 60 Query: 61 EAGMIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRV 120 EAGMIQLGGQAIFLS RDTQLGRGEPI+D A VMS MLDAVMIRT+AHS LTEFAA+SRV Sbjct: 61 EAGMIQLGGQAIFLSPRDTQLGRGEPISDCAIVMSGMLDAVMIRTFAHSTLTEFAAHSRV 120 Query: 121 PVINGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRV 180 PVINGLSDDLHPCQLLADMQTFLEHRGSI+GKTVAWIGDGNNMCNSYIEAA+QFDFQLR+ Sbjct: 121 PVINGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAALQFDFQLRI 180 Query: 181 ACPAGYEPNPEFLALAGERVTIVRDPKAAVAGAHLVSTDVWTSMGQEEETARRMALFAPF 240 ACP GY+PN E LA AGERVTIVRDPK AVAGAHLVSTDVWTSMGQEEETA+R+ LFAP Sbjct: 181 ACPEGYDPNAELLAKAGERVTIVRDPKQAVAGAHLVSTDVWTSMGQEEETAKRLELFAPL 240 Query: 241 QVTRASLDLAEKDVLFMHCLPAHRGEEISVDLLDDSRSVAWDQAENRLHAQKALLEFLVA 300 QV RA LDLA+ DVLFMHCLPAHRGEEIS DLLDD RSVAWDQAENRLHAQKALLEFLV Sbjct: 241 QVNRALLDLADADVLFMHCLPAHRGEEISFDLLDDPRSVAWDQAENRLHAQKALLEFLVE 300 Query: 301 PSHQRA 306 P++ A Sbjct: 301 PAYHHA 306 Lambda K H 0.322 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 306 Length adjustment: 27 Effective length of query: 279 Effective length of database: 279 Effective search space: 77841 Effective search space used: 77841 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate Pf6N2E2_5579 (Ornithine carbamoyltransferase (EC 2.1.3.3))
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00658.hmm # target sequence database: /tmp/gapView.703.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-116 374.1 0.0 2.8e-116 373.9 0.0 1.0 1 lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5579 Ornithine carbamoyltransferase ( Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5579 Ornithine carbamoyltransferase (EC 2.1.3.3) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 373.9 0.0 2.8e-116 2.8e-116 1 303 [. 4 299 .. 4 300 .. 0.99 Alignments for each domain: == domain 1 score: 373.9 bits; conditional E-value: 2.8e-116 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayel 64 rh+lsl+d++++el ++ ++ +lk +++g+ + lk++ l++iFek+stRtR+sfe+++++l lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5579 4 RHFLSLMDFTPDELLGVIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRISFEAGMIQL 67 8*************************************************************** PP TIGR00658 65 GaqvlylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdleh 128 G+q+++l++ ++qlgr+e+i+D a v+s ++da+++R+++h++++e+a ++ vPvingL+d h lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5579 68 GGQAIFLSPRDTQLGRGEPISDCAIVMSGMLDAVMIRTFAHSTLTEFAAHSRVPVINGLSDDLH 131 **************************************************************** PP TIGR00658 129 PcqilaDlltikeklgklkevklvyvGDannvanslllaaaklGldvvvatPeglepeaeivkk 192 Pcq+laD++t e+ g++++ +++++GD+nn++ns + aa+++ +++++a+Peg++p+ae++ k lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5579 132 PCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAALQFDFQLRIACPEGYDPNAELLAK 195 *************************************************************999 PP TIGR00658 193 akkiakenggkleltedpkkavkdadviytDvwvsmGeeekkeerlkllkpyqvneellelakp 256 a g ++++++dpk+av++a+++ tDvw+smG+ee++++rl+l+ p qvn+ ll+la+ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5579 196 A-------GERVTIVRDPKQAVAGAHLVSTDVWTSMGQEEETAKRLELFAPLQVNRALLDLADA 252 8.......77****************************************************** PP TIGR00658 257 evkflhCLPavrGeevtdevlegeasivfdeaenRlhaqkavlkall 303 +v f+hCLPa+rGee++ + l+ ++s+ +d+aenRlhaqka+l++l+ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5579 253 DVLFMHCLPAHRGEEISFDLLDDPRSVAWDQAENRLHAQKALLEFLV 299 *******************************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (306 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 11.24 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory