Align diaminopimelate decarboxylase (EC 4.1.1.20) (characterized)
to candidate RR42_RS19050 RR42_RS19050 diaminopimelate decarboxylase
Query= BRENDA::Q9KVL7 (417 letters) >FitnessBrowser__Cup4G11:RR42_RS19050 Length = 422 Score = 483 bits (1242), Expect = e-141 Identities = 247/420 (58%), Positives = 313/420 (74%), Gaps = 5/420 (1%) Query: 1 MDYFNYQEDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDYPHLICYAV 60 M F ++ DG L E VPLA +A +YGTP YVYSRA L + A+ + + YA+ Sbjct: 1 MTAFFHRHDGALSVEHVPLARIAAEYGTPTYVYSRAALTAAYQAYAAACQGRRARVQYAM 60 Query: 61 KANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKI 120 KANSNL +L ARLG+GFDIVS GEL+RVLA GGDP KVVFSGVGKT AEM+ ALQ + Sbjct: 61 KANSNLAILQVFARLGAGFDIVSGGELQRVLAVGGDPRKVVFSGVGKTAAEMELALQHDV 120 Query: 121 KCFNVESEPELQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAA 180 FNVES PEL RLN VAG LG +A +SLRINPDVDAKTHPYISTGL+ NKFG+ F+ Sbjct: 121 LSFNVESIPELDRLNAVAGRLGKRARVSLRINPDVDAKTHPYISTGLKGNKFGVAFEDVL 180 Query: 181 QVYRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGG 240 YR A +LP+L+V GIDCHIGSQ+T +AP+++A D++L ++++L+ EGI++ H+DVGGG Sbjct: 181 PTYRAAAALPHLEVAGIDCHIGSQITEVAPYLEALDKVLDVVEALEREGINLEHIDVGGG 240 Query: 241 LGVVYRDELPPQPSEYAKALLDRLER--HRDLELIFEPGRAIAANAGVLVTKVEFLKHTE 298 LG+ Y DE PP + +A+ LLDR+ H E++FEPGR++ NAGVL+T+VEFLK Sbjct: 241 LGITYDDETPPDITGFARTLLDRVAERGHGHREVLFEPGRSLVGNAGVLLTQVEFLKPGA 300 Query: 299 HKNFAIIDAAMNDLIRPALYQAWQDIIPLRPR---QGEAQTYDLVGPVCETSDFLGKDRD 355 KNF I+DAAMNDL RPA+Y+A+ I P++ R Q A TYD+VGPVCE+ D+LG+DR Sbjct: 301 AKNFCIVDAAMNDLARPAMYEAYHRIEPVQLREAAQATALTYDVVGPVCESGDWLGRDRA 360 Query: 356 LVLQEGDLLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALESVL 415 L +Q GDLLAV S+GAYGF MSSNYNTRPR AEVMVDG+ +LVR RE ++ L+ E +L Sbjct: 361 LAVQPGDLLAVMSAGAYGFVMSSNYNTRPRAAEVMVDGDDVHLVRGREHVADLFRDERLL 420 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 498 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 422 Length adjustment: 32 Effective length of query: 385 Effective length of database: 390 Effective search space: 150150 Effective search space used: 150150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate RR42_RS19050 RR42_RS19050 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.22137.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-163 528.3 0.0 6.1e-163 528.1 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS19050 RR42_RS19050 diaminopimelate dec Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS19050 RR42_RS19050 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 528.1 0.0 6.1e-163 6.1e-163 4 416 .. 7 417 .. 4 418 .. 0.97 Alignments for each domain: == domain 1 score: 528.1 bits; conditional E-value: 6.1e-163 TIGR01048 4 kkdgeleiegvdlkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllaee 72 ++dg l++e+v+l+++a+e+gtP+Yvy++++l+++++a+++a ++++++v YA+KAnsnla+l+++a++ lcl|FitnessBrowser__Cup4G11:RR42_RS19050 7 RHDGALSVEHVPLARIAAEYGTPTYVYSRAALTAAYQAYAAACQGRRARVQYAMKANSNLAILQVFARL 75 6799*****************************************999********************* PP TIGR01048 73 GlgldvvsgGEleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgkk 141 G+g+d+vsgGEl+r+la g ++ k+vfsg+gk+ +e+e al++++ +nv+s+ el++l+++a++lgk+ lcl|FitnessBrowser__Cup4G11:RR42_RS19050 76 GAGFDIVSGGELQRVLAVGGDPRKVVFSGVGKTAAEMELALQHDVLSFNVESIPELDRLNAVAGRLGKR 144 ********************************************************************* PP TIGR01048 142 arvllRvnpdvdaktheyisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfve 210 arv+lR+npdvdakth+yisTGlk +KFG+++e+ +++y++a++l++le+ Gi++HIGSqi++++p+ e lcl|FitnessBrowser__Cup4G11:RR42_RS19050 145 ARVSLRINPDVDAKTHPYISTGLKGNKFGVAFEDVLPTYRAAAALPHLEVAGIDCHIGSQITEVAPYLE 213 ********************************************************************* PP TIGR01048 211 aaekvvklleelkeegieleeldlGGGlgisyeeeeeapdleeyaeklleklekeaelgl.klklilEp 278 a++kv++++e l++egi+le++d+GGGlgi+y++e+ +pd++ +a++ll++++++ g+ + ++++Ep lcl|FitnessBrowser__Cup4G11:RR42_RS19050 214 ALDKVLDVVEALEREGINLEHIDVGGGLGITYDDET-PPDITGFARTLLDRVAER---GHgHREVLFEP 278 **********************************99.************999995...66699****** PP TIGR01048 279 GRslvanagvlltrVesvKevesrkfvlvDagmndliRpalYeayheiaalkr..leeeetetvdvvGp 345 GRslv+nagvllt+Ve++K ++f++vDa+mndl Rpa+Yeayh+i +++ ++++ t+dvvGp lcl|FitnessBrowser__Cup4G11:RR42_RS19050 279 GRSLVGNAGVLLTQVEFLKPGAAKNFCIVDAAMNDLARPAMYEAYHRIEPVQLreAAQATALTYDVVGP 347 ************************************************998642266777889****** PP TIGR01048 346 lCEsgDvlakdrelpeveeGdllavasaGAYgasmssnYnsrprpaevlveegkarlirrretledlla 414 +CEsgD l++dr+l v++Gdllav+saGAYg+ mssnYn+rpr+aev+v++++++l+r re ++dl++ lcl|FitnessBrowser__Cup4G11:RR42_RS19050 348 VCESGDWLGRDRALA-VQPGDLLAVMSAGAYGFVMSSNYNTRPRAAEVMVDGDDVHLVRGREHVADLFR 415 **************6.789************************************************99 PP TIGR01048 415 le 416 +e lcl|FitnessBrowser__Cup4G11:RR42_RS19050 416 DE 417 87 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (422 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.00 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory