Align Cystathionine beta-lyase MetC; CBL; Beta-cystathionase MetC; Cysteine lyase MetC; Cysteine-S-conjugate beta-lyase MetC; EC 4.4.1.13 (characterized)
to candidate SMc01666 SMc01666 methionine gamma-lyase
Query= SwissProt::O31632 (390 letters) >FitnessBrowser__Smeli:SMc01666 Length = 427 Score = 220 bits (561), Expect = 5e-62 Identities = 143/418 (34%), Positives = 219/418 (52%), Gaps = 35/418 (8%) Query: 1 MSKHNWTLETQLVHNPFKTDGGTGAVSVPIQHASTFHQSSFEE----------------- 43 + H ET +++ + + GAV PI STF S EE Sbjct: 11 IGNHKLHPETLMLNYGYDPELSEGAVKPPIFLTSTFVFHSAEEGRDFFDFVSGRREPPAG 70 Query: 44 FGA-YDYSRSGTPTRTALEETIAALEGGTRGFAFSSGMAAISTAFL-LLSQGDHVLVTED 101 GA YSR P +E+ +A E G FSSGM+AI+T L + GD +L ++ Sbjct: 71 VGAGLVYSRFNHPNSEIVEDRLAIFERAEAGALFSSGMSAIATTLLAFVRPGDSILHSQP 130 Query: 102 VYGGTFRMVTEVLTRFGIEHT-FVDMTDRNEVARSI-----KPNTKVIYMETPSNPTLGI 155 +YGGT ++ + G+ F D TD V + K VI +ETP+NPT + Sbjct: 131 LYGGTETLLAKTFLNLGVSAVGFADGTDEAAVNAAAEEAMSKGRVSVILIETPANPTNSL 190 Query: 156 TDIKAVVQLAKENG------CLTFLDNTFMTPALQRPLDLGVDIVLHSATKFLSGHSDVL 209 D+ V ++A+ G + DNT + P Q P++ G D+ L+S TK++ GHSD++ Sbjct: 191 VDVALVRRIAERIGERQAHRPIVACDNTLLGPVFQHPIEHGADLSLYSLTKYVGGHSDLI 250 Query: 210 SGLAAVKDEELGKQLYKLQNAFGAVLGVQDCWLVLRGLKTLQVRLEKASQTAQRLAEFFQ 269 +G A + + L +Q+ L+ + G L CW++ R L+TL VR+EKA+ A+ +AEF + Sbjct: 251 AG-AVLGSKALIRQVKALRGSIGTQLDPHSCWMIGRSLETLSVRMEKANDNARIVAEFLR 309 Query: 270 KHPAVKRVYYPGL--ADHPGAETHKSQSTGAGAVLSFELES-KEAVKKLVENVSLPVFAV 326 HP V+R++Y AD P +Q TGAG+ SF++ +EA + + + + AV Sbjct: 310 DHPKVERIHYLPFHDADTPVGRVFATQCTGAGSTFSFDIAGGQEAAFRFLNALQIFKLAV 369 Query: 327 SLGAVESILSYPATMSHAAMPKEEREKRGITDGLLRLSVGVEHADDLEHDFEQALKEI 384 SLG ES+ S+PA M+H+ +P E R + G+ + +RLS+G+EH DDL D AL I Sbjct: 370 SLGGTESLASHPAAMTHSGVPIEVRARIGVLESTIRLSIGIEHPDDLVADVANALTMI 427 Lambda K H 0.317 0.132 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 420 Number of extensions: 27 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 390 Length of database: 427 Length adjustment: 31 Effective length of query: 359 Effective length of database: 396 Effective search space: 142164 Effective search space used: 142164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory