Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate Synpcc7942_0597 Synpcc7942_0597 naphthoate synthase
Query= BRENDA::Q1D5Y4 (258 letters) >FitnessBrowser__SynE:Synpcc7942_0597 Length = 279 Score = 108 bits (270), Expect = 1e-28 Identities = 87/253 (34%), Positives = 121/253 (47%), Gaps = 19/253 (7%) Query: 16 TIDGESRRNAISRAMLKELGELVTRVSSSRDVRAVVITGAGDK-----AFCAGADLKERA 70 TI+ +RNA + EL + + +++TGAG AFCAG D R Sbjct: 28 TINRPHKRNAFRPKTVVELYDAFCDAREDIAIGVILLTGAGPHTDGRYAFCAGGDQSVRG 87 Query: 71 TMA----EDEVRAFLDGLRRTFRAIEKSDCVFIAAINGAALGGGTELALACDLRVAAPAA 126 E R + L+R R I K V IA + G A+GGG L + CDL +AA A Sbjct: 88 AGGYIDEEGLPRLNVLDLQRLIRTIPK---VVIALVAGYAIGGGHVLHILCDLTIAADNA 144 Query: 127 ELGLTEVKLGIIPGGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRLAPEGHL 186 G T K+G GG G LARLVG +A+++ R+ A EA +GL N + P L Sbjct: 145 VFGQTGPKVGSFDGGFGASYLARLVGQKKAREIWFLCRQYGAKEALQMGLVNTVVPVEEL 204 Query: 187 LAVAYGLAESVVENAPIAVATAKHAIDEGTGLELDDALAL-ELRKYEEIL--KTEDRLEG 243 A A ++E +PIA+ K A + ELD + EL + L TE+ EG Sbjct: 205 EAEGIRWALEILEKSPIAIRCLKAAFN----AELDGMAGIQELAGHATHLYYLTEEGSEG 260 Query: 244 LRAFAEKRAPVYK 256 +AF EKR+P ++ Sbjct: 261 KQAFLEKRSPDFR 273 Lambda K H 0.319 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 279 Length adjustment: 25 Effective length of query: 233 Effective length of database: 254 Effective search space: 59182 Effective search space used: 59182 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory