Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (uncharacterized)
to candidate Synpcc7942_1440 Synpcc7942_1440 homoserine kinase
Query= curated2:Q31N99 (306 letters) >FitnessBrowser__SynE:Synpcc7942_1440 Length = 306 Score = 603 bits (1556), Expect = e-177 Identities = 306/306 (100%), Positives = 306/306 (100%) Query: 1 MRVRVAVPATTANLGPGFDCLGAALTLYNHFWFAPASTGELEITARGMDAEKISGDRDNL 60 MRVRVAVPATTANLGPGFDCLGAALTLYNHFWFAPASTGELEITARGMDAEKISGDRDNL Sbjct: 1 MRVRVAVPATTANLGPGFDCLGAALTLYNHFWFAPASTGELEITARGMDAEKISGDRDNL 60 Query: 61 VYRAFAAFFEKQEQPVPALKLEIELAVPLARGLGSSATAIVAGLVGANALAGSPWSNAQL 120 VYRAFAAFFEKQEQPVPALKLEIELAVPLARGLGSSATAIVAGLVGANALAGSPWSNAQL Sbjct: 61 VYRAFAAFFEKQEQPVPALKLEIELAVPLARGLGSSATAIVAGLVGANALAGSPWSNAQL 120 Query: 121 CDLATELEGHPDNVVPALLGGCRLAARDRQNQWAIADLDWHPDFIPVVAIPDFELSTEAA 180 CDLATELEGHPDNVVPALLGGCRLAARDRQNQWAIADLDWHPDFIPVVAIPDFELSTEAA Sbjct: 121 CDLATELEGHPDNVVPALLGGCRLAARDRQNQWAIADLDWHPDFIPVVAIPDFELSTEAA 180 Query: 181 RQVLPTQYSRSDAIFNAAHVGLVVRSLASGNGEWLAAALQDRLHQPYRQALIPGYAAVET 240 RQVLPTQYSRSDAIFNAAHVGLVVRSLASGNGEWLAAALQDRLHQPYRQALIPGYAAVET Sbjct: 181 RQVLPTQYSRSDAIFNAAHVGLVVRSLASGNGEWLAAALQDRLHQPYRQALIPGYAAVET 240 Query: 241 AALEAGAFGLVISGAGPTLLAISSPDRAEAVRQAMLTTWQATGLSVRAEILAIAESGTQI 300 AALEAGAFGLVISGAGPTLLAISSPDRAEAVRQAMLTTWQATGLSVRAEILAIAESGTQI Sbjct: 241 AALEAGAFGLVISGAGPTLLAISSPDRAEAVRQAMLTTWQATGLSVRAEILAIAESGTQI 300 Query: 301 EQETEN 306 EQETEN Sbjct: 301 EQETEN 306 Lambda K H 0.318 0.132 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 451 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 306 Length adjustment: 27 Effective length of query: 279 Effective length of database: 279 Effective search space: 77841 Effective search space used: 77841 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate Synpcc7942_1440 Synpcc7942_1440 (homoserine kinase)
to HMM TIGR00191 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00191.hmm # target sequence database: /tmp/gapView.27276.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00191 [M=304] Accession: TIGR00191 Description: thrB: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-95 305.4 0.0 1.9e-95 305.2 0.0 1.0 1 lcl|FitnessBrowser__SynE:Synpcc7942_1440 Synpcc7942_1440 homoserine kinas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SynE:Synpcc7942_1440 Synpcc7942_1440 homoserine kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 305.2 0.0 1.9e-95 1.9e-95 1 303 [. 3 302 .. 3 303 .. 0.96 Alignments for each domain: == domain 1 score: 305.2 bits; conditional E-value: 1.9e-95 TIGR00191 1 lkvkvPassANlgpGfDvlGlalslvlellvtedvaqeskdksleaegegvekipkesdkNliyqvakk 69 ++v vPa++ANlgpGfD+lG+al+l++++ + ++ + +++a+g ++eki+ + ++Nl+y++++ lcl|FitnessBrowser__SynE:Synpcc7942_1440 3 VRVAVPATTANLGPGFDCLGAALTLYNHFWFAP---ASTGELEITARGMDAEKISGD-RDNLVYRAFAA 67 68******************************9...667777899***********9.*********** PP TIGR00191 70 vlkklgkrvkpvkltvekeiplgrGLGSSaaaivaaviaanelaglklskeelldlalllEgHpDNvap 138 +++k+++ v+++kl++e +pl+rGLGSSa+aiva+++ an+lag + s+++l dla++lEgHpDNv p lcl|FitnessBrowser__SynE:Synpcc7942_1440 68 FFEKQEQPVPALKLEIELAVPLARGLGSSATAIVAGLVGANALAGSPWSNAQLCDLATELEGHPDNVVP 136 ********************************************************************* PP TIGR00191 139 allGGlqlavkedd.llevlkvPsgsklkvvlviPnievsTaeaRavLPkaysrqdlvfnlshlavlvt 206 allGG+ la ++ + + + ++ ++++ v++iP +e+sT++aR+vLP +ysr+d++fn++h++++v lcl|FitnessBrowser__SynE:Synpcc7942_1440 137 ALLGGCRLAARDRQnQWAIADLDWHPDFIPVVAIPDFELSTEAARQVLPTQYSRSDAIFNAAHVGLVVR 205 ********998777556666777779******************************************* PP TIGR00191 207 AlvskdkadllaiamkDrvhqpyRekliPelteikqaakekgalgitlSGaGptilalaeeek.eekaq 274 l s+ + ++la a++Dr+hqpyR+ liP+++++++aa e+ga+g+++SGaGpt+la+++ + e q lcl|FitnessBrowser__SynE:Synpcc7942_1440 206 SLASG-NGEWLAAALQDRLHQPYRQALIPGYAAVETAALEAGAFGLVISGAGPTLLAISSPDRaEAVRQ 273 *****.*****************************************************9999799999 PP TIGR00191 275 elleklakegieltvkvleldtdgaevek 303 +l +++ g ++ ++l ++ g+++e+ lcl|FitnessBrowser__SynE:Synpcc7942_1440 274 AMLTTWQATGLSVRAEILAIAESGTQIEQ 302 ***************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (306 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 8.17 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory